[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57497.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:251 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   52->103 PF02575 * DUF149 0.00048 25.0 52/93  
:HMM:PFM   84->123 PF02120 * Flg_hook 0.00085 25.0 40/85  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57497.1 GT:GENE BAD57497.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2816051..2816806) GB:FROM 2816051 GB:TO 2816806 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57497.1 LENGTH 251 SQ:AASEQ MVPSPRPSTPMPSVARDSASTEELLDKTLQFHARMARSRRLLDSVSHNGPRSVVGYDRTRCVSVTVGTRDEFLRAHVDDHWERRLDPGHLGQAVIDAAQDAQRVRSAGTAIAPAVLQRLRARSDNDLAPSPLGAPPNVGDPSIRSARQLAGEMLDLASNASGHSDTENAGHGAGAEGWVRAAVNSTGVLVGCDVAAYWAAGRDGSEIAAAIDQAVADALRDLATKPAAPDPLTQANRLITDGLAYLVNHDR GT:EXON 1|1-251:0| SEG 207->218|iaaaidqavada| HM:PFM:NREP 2 HM:PFM:REP 52->103|PF02575|0.00048|25.0|52/93|DUF149| HM:PFM:REP 84->123|PF02120|0.00085|25.0|40/85|Flg_hook| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 124-125, 158-171, 250-251| PSIPRED ccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHccccEEEEcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccc //