[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57499.1
DDBJ      :             putative polypeptide deformylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  646/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
d.167.1
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->180 3e3uA PDBj 2e-39 48.6 %
:RPS:PDB   1->184 3cpmA PDBj 3e-45 25.7 %
:RPS:SCOP  2->150 1bs4A  d.167.1.1 * 1e-39 33.1 %
:HMM:SCOP  2->174 1y6hA_ d.167.1.1 * 8.8e-50 40.5 %
:RPS:PFM   3->150 PF01327 * Pep_deformylase 5e-24 45.8 %
:HMM:PFM   3->154 PF01327 * Pep_deformylase 1.9e-43 42.9 147/157  
:BLT:SWISS 1->183 DEF_MYCLE 5e-45 52.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57499.1 GT:GENE BAD57499.1 GT:PRODUCT putative polypeptide deformylase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2817799..2818371 GB:FROM 2817799 GB:TO 2818371 GB:DIRECTION + GB:PRODUCT putative polypeptide deformylase GB:PROTEIN_ID BAD57499.1 LENGTH 190 SQ:AASEQ MAIRPILIAGDPRLTTPAQPVTVFDDELAALVDDLFDTLAAAEGAGLAANQIGDPRAVFVYDLVDHGHRYRGVVVNPVAETSALPETMPDPEGDLEGCLSVPGEWYPTGRADRARVTGLDATGAPITVEGTGYLARCLQHETDHLAGRLYLERLLGRHARAARRMIKAHGWTVPGNTWLPPKVRAGERFN GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 1->183|DEF_MYCLE|5e-45|52.5|183/197| SEG 39->49|laaaegaglaa| SEG 151->164|lerllgrharaarr| BL:PDB:NREP 1 BL:PDB:REP 2->180|3e3uA|2e-39|48.6|179/196| RP:PDB:NREP 1 RP:PDB:REP 1->184|3cpmA|3e-45|25.7|179/184| RP:PFM:NREP 1 RP:PFM:REP 3->150|PF01327|5e-24|45.8|142/155|Pep_deformylase| HM:PFM:NREP 1 HM:PFM:REP 3->154|PF01327|1.9e-43|42.9|147/157|Pep_deformylase| GO:PFM:NREP 3 GO:PFM GO:0005506|"GO:iron ion binding"|PF01327|IPR000181| GO:PFM GO:0006412|"GO:translation"|PF01327|IPR000181| GO:PFM GO:0042586|"GO:peptide deformylase activity"|PF01327|IPR000181| RP:SCP:NREP 1 RP:SCP:REP 2->150|1bs4A|1e-39|33.1|142/168|d.167.1.1| HM:SCP:REP 2->174|1y6hA_|8.8e-50|40.5|168/0|d.167.1.1|1/1|Peptide deformylase| OP:NHOMO 865 OP:NHOMOORG 655 OP:PATTERN -------------------------------------------------------------------- 1211322222222211111-1111111111111111322112212121222222222211222122333221111111-11111-111--------1-----------111111111---1111-1--------1------111-1---1---1111--111---11111-1111---11111--1--111111111111111111111--11111111111-11------31----------------11------------------------------------------------------------------------11-1-3333321-2-2-112111111-11111-11121-111111111---11-111111-1211---111111122222221222-111111221121222111211111-1111222-1--111--------22211111111111111111111111111-11-11111-11112222221111222222222222222212222221222222222222222332222212111111122222211-1-11--1---1--1-121121111133-1-1111-----1-1-------11111112111112111112222222222222222221-11121-1-11111111111111111121-1111111111111111111112112121111111111111111111111111111111111111111111111-11112111111111111111111111111111111112222222122221222---------111122222212122112222222211111-11111111--------1-----------------------------1--1-111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-2213-11------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 96.8 SQ:SECSTR ccccccccTTcGGGTccccccccccHHHHHHHHHHHHHHHHTTccEEEGGGGTccccEEEEcccccTccccEEEEEEEEEEccEEEEcccEEEEEEccTTcTTccEEEEEEccEEEEEEcTTccEEEEEEcHHHHHHHHHHHHHHTTccGGGGccHHHHHTTHHHHHHHHHHHHHHHccccccc###### DISOP:02AL 184-190| PSIPRED cccHHHHHcccHHHcccccccccccHHHHHHHHHHHHHHHHccccEEEEccccccEEEEEEEcccccccccEEEEccEEEEccccHHcccccccccccEEccccEEEEccccEEEEEEEcccccEEEEEEcccEEEEEEEEHHHcccEEEEEEccHHHHHHHHHHHHHcccccccccccccccccccccc //