[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57515.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   10->133 3cnbA PDBj 2e-06 14.2 %
:RPS:SCOP  9->131 1dz3A  c.23.1.1 * 1e-05 13.4 %
:HMM:SCOP  7->131 1s8nA_ c.23.1.1 * 2.6e-07 24.8 %
:HMM:PFM   44->125 PF00072 * Response_reg 3.6e-06 27.2 81/112  
:BLT:SWISS 47->131 VANR_ENTFC 3e-04 33.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57515.1 GT:GENE BAD57515.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2836801..2837211) GB:FROM 2836801 GB:TO 2837211 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57515.1 LENGTH 136 SQ:AASEQ MADEMRSTALRVLVYSNDADTRRQVVLALGPRPHPDLAEFDYLEVATAPMVIERMDAGGIDLAILDGEATPAGGLGIAKQLKDELAQCPPVLVLTGRPDDAWLAKWSRAEAAVPHPIDPLRLTESVVELLRDRSAA GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 47->131|VANR_ENTFC|3e-04|33.7|83/100| RP:PDB:NREP 1 RP:PDB:REP 10->133|3cnbA|2e-06|14.2|120/124| HM:PFM:NREP 1 HM:PFM:REP 44->125|PF00072|3.6e-06|27.2|81/112|Response_reg| RP:SCP:NREP 1 RP:SCP:REP 9->131|1dz3A|1e-05|13.4|119/123|c.23.1.1| HM:SCP:REP 7->131|1s8nA_|2.6e-07|24.8|117/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-11--11111111111111111111-1--1-----------11111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 97.1 SQ:SECSTR ####ccccccEEEEEcccHHHHHHHHHHHHHHcTTEEEEcEEEEEccHHHHHHHHHHTcccEEEEETTcTTccHHHHHHHHHcTTTTTcEEEEEEccccHHHHHHHHHTTccEEccccHHHHHHHHHHHHHTTHHG DISOP:02AL 1-8, 134-136| PSIPRED cccccccccEEEEEEEccHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHcccccEEcccccHHHHHHHHHHHHHHHHcc //