[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57518.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  195/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:307 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->73 1iz1B PDBj 6e-04 41.5 %
:BLT:PDB   137->228 2ql3A PDBj 6e-07 36.5 %
:RPS:PDB   14->97 1b9nA PDBj 4e-15 16.9 %
:RPS:SCOP  14->97 1b9mA1  a.4.5.8 * 7e-14 16.7 %
:RPS:SCOP  123->228 1utbA  c.94.1.1 * 2e-05 12.9 %
:HMM:SCOP  1->113 1b9mA1 a.4.5.8 * 7.4e-25 50.9 %
:HMM:SCOP  86->293 1uthA_ c.94.1.1 * 7.9e-32 32.7 %
:RPS:PFM   14->62 PF00126 * HTH_1 6e-05 49.0 %
:HMM:PFM   90->292 PF03466 * LysR_substrate 3.7e-37 30.8 198/209  
:HMM:PFM   4->63 PF00126 * HTH_1 1.6e-19 45.0 60/60  
:BLT:SWISS 17->176 NAC_KLEAE 5e-12 32.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57518.1 GT:GENE BAD57518.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2839102..2840025) GB:FROM 2839102 GB:TO 2840025 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57518.1 LENGTH 307 SQ:AASEQ MLDLRRLRLLRELAHRGTIAAVADALSYTPSAVSQQLTALEREAGRPLLIRTGRRVELTPAGRLLVEHAETLLADMERARAALARHDSVLAGTVRLGAFTTALPTLVLPALAALARSAPDLAVDITEVDPAEVPNLLRGGRLDLALVHEYDNVPSALGAGLDLEPLLVEAVHLACPASWNPDREITLGDHAESRWILANPGTLCHSMAVRTCRAHGFEPRVAHHIDDFATVLRLVAAGAGVALVPHLGVDHLPAGVRLAALPVGRRTRIAYRRGSADQPLFAAVAAELHRAAAAFRADDGIRLDENS GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 17->176|NAC_KLEAE|5e-12|32.3|155/305| SEG 2->13|ldlrrlrllrel| SEG 98->122|afttalptlvlpalaalarsapdla| SEG 229->249|atvlrlvaagagvalvphlgv| SEG 280->297|lfaavaaelhraaaafra| BL:PDB:NREP 2 BL:PDB:REP 33->73|1iz1B|6e-04|41.5|41/294| BL:PDB:REP 137->228|2ql3A|6e-07|36.5|85/200| RP:PDB:NREP 1 RP:PDB:REP 14->97|1b9nA|4e-15|16.9|83/258| RP:PFM:NREP 1 RP:PFM:REP 14->62|PF00126|6e-05|49.0|49/60|HTH_1| HM:PFM:NREP 2 HM:PFM:REP 90->292|PF03466|3.7e-37|30.8|198/209|LysR_substrate| HM:PFM:REP 4->63|PF00126|1.6e-19|45.0|60/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 14->97|1b9mA1|7e-14|16.7|84/122|a.4.5.8| RP:SCP:REP 123->228|1utbA|2e-05|12.9|101/214|c.94.1.1| HM:SCP:REP 1->113|1b9mA1|7.4e-25|50.9|106/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 86->293|1uthA_|7.9e-32|32.7|202/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 357 OP:NHOMOORG 196 OP:PATTERN -------------------------------------------------------------------- --1-51--111---3---------12-----1122235BC-2113-21-2217562-2--1-1-53B6856------------------------------------------------------------------22-----1----1----------------------------------1---------11111111-111111--11--111111----1----11-----------------------1----------------------------------------------------------------------1------------------------1----11---------------1------------11----1----1112-112212--22122-31-1--2111-111112-2----1-11111-1----------------------------------------------------221111333413----3313------41222----332112-1116151-1-----1------------1-------------------1--1--11-1-------------------------------2---------1--------------------------------1111122-----------------------------1121------------------------1----------------------------------1----1-----------11--1-----1-11-121-2112-11-12-------------1-----------1--1------------------------------------------------------------------2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 70.0 SQ:SECSTR #############HHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccTTcHHHHHTTHHTTTccccccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTccTTcEEHEEEEcGGGcEEEccHHHHTTccEEEEEEEEEEEEcccEEEEEEcTTccEEEEEEEGGGcTTccTTcEEEEccH############################################################################### DISOP:02AL 83-89, 298-307| PSIPRED cccHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEEcccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEEEEccccccccccccEEEEEEEEccEEEEEcccccccccccHHHHccccEEEccccccHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHccHHHHHHHHHHHHHccccEEEEcccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccc //