[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57520.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->76 3dcfB PDBj 4e-04 27.8 %
:RPS:PDB   1->73 2dt5A PDBj 2e-05 5.8 %
:RPS:SCOP  2->78 1t56A1  a.4.1.9 * 6e-09 24.7 %
:HMM:SCOP  1->79 2fbqA1 a.4.1.9 * 4.2e-14 25.3 %
:HMM:SCOP  77->202 2np5A2 a.121.1.1 * 7.8e-14 34.5 %
:HMM:PFM   9->53 PF00440 * TetR_N 1.5e-13 37.8 45/47  
:BLT:SWISS 5->63 BETI_AGRT5 2e-05 33.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57520.1 GT:GENE BAD57520.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2841026..2841631) GB:FROM 2841026 GB:TO 2841631 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57520.1 LENGTH 201 SQ:AASEQ MGDERRRQITDAARRVIVRGGLAAATFQAVAAEAGISVRLVQYYFGTKNDFLLGTLKAVLDDMAVRFIRHVEALGPDPDPRAAMRATALALLPLDETRRAEALVLSAYQTARLTGSPTIPGETLEAPRLLAQTFAGHLRRARGSDTDTHTSDTDTEADAELLTGILVGLTQSTLAGYHTPDRATALVDHALDRLLGSAPRR GT:EXON 1|1-201:0| BL:SWS:NREP 1 BL:SWS:REP 5->63|BETI_AGRT5|2e-05|33.9|59/206| SEG 23->34|aaatfqavaaea| SEG 80->94|praamratalallpl| SEG 144->160|sdtdthtsdtdteadae| BL:PDB:NREP 1 BL:PDB:REP 3->76|3dcfB|4e-04|27.8|72/181| RP:PDB:NREP 1 RP:PDB:REP 1->73|2dt5A|2e-05|5.8|69/210| HM:PFM:NREP 1 HM:PFM:REP 9->53|PF00440|1.5e-13|37.8|45/47|TetR_N| RP:SCP:NREP 1 RP:SCP:REP 2->78|1t56A1|6e-09|24.7|73/73|a.4.1.9| HM:SCP:REP 1->79|2fbqA1|4.2e-14|25.3|79/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 77->202|2np5A2|7.8e-14|34.5|116/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------12-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 201 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHHHHHHHTTccEEcHHHHHHHHTccHHHHHHHHHHTTccccHHHHTTTcEEHHHHHHHHHHccccHHHHHHHHHHHHTcHHHHcGGGHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHHHHHTGGGG DISOP:02AL 1-3, 198-201| PSIPRED ccHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccc //