[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57522.1
DDBJ      :             putative MutT family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->121 3hhjB PDBj 2e-04 30.5 %
:RPS:PDB   13->134 2azwA PDBj 1e-11 18.9 %
:RPS:SCOP  13->134 2azwA1  d.113.1.1 * 1e-11 18.9 %
:HMM:SCOP  8->133 1vcdA1 d.113.1.1 * 3.5e-15 25.0 %
:HMM:PFM   24->116 PF00293 * NUDIX 3.6e-11 25.8 93/135  
:BLT:SWISS 9->111 NUDG_ECOLI 3e-05 38.5 %
:PROS 39->60|PS00893|NUDIX_BOX
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57522.1 GT:GENE BAD57522.1 GT:PRODUCT putative MutT family protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2842883..2843299 GB:FROM 2842883 GB:TO 2843299 GB:DIRECTION + GB:PRODUCT putative MutT family protein GB:PROTEIN_ID BAD57522.1 LENGTH 138 SQ:AASEQ MREGPVTTLIDTVAWVHIVRGRILCARPRGKDVFFIPGGKREGAESDLDTLLREIREELTVALIAGTVAAVGVYEAGAHAPGDDVLVRMACYTAEYRGTLAASSEIDELAWFGYADRPRVPPVDRLLFDDLHAAGLLE GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 9->111|NUDG_ECOLI|3e-05|38.5|96/135| PROS 39->60|PS00893|NUDIX_BOX|PDOC00695| TM:NTM 2 TM:REGION 4->26| TM:REGION 56->78| BL:PDB:NREP 1 BL:PDB:REP 23->121|3hhjB|2e-04|30.5|95/131| RP:PDB:NREP 1 RP:PDB:REP 13->134|2azwA|1e-11|18.9|122/146| HM:PFM:NREP 1 HM:PFM:REP 24->116|PF00293|3.6e-11|25.8|93/135|NUDIX| RP:SCP:NREP 1 RP:SCP:REP 13->134|2azwA1|1e-11|18.9|122/146|d.113.1.1| HM:SCP:REP 8->133|1vcdA1|3.5e-15|25.0|120/0|d.113.1.1|1/1|Nudix| OP:NHOMO 37 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2111---------1-----1----1----11--11--------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1-----------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------1-----------------------------------------------------------1------------------1--------------------------------------1----------------------------------------1-----1-11-1--1--1-----1-1--1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 100.0 SQ:SECSTR GTccEEEEEEEEEEEcEEGGGTEEEEEEcTTccEEccEEEccTTccHHHHHHHHHHHHHcEEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEEEEEccccccccEEEEEcHHHHHcccHHHHHHHHHHHHcTccE DISOP:02AL 1-6| PSIPRED ccccccccEEEEEEEEEEccccEEEEEEcccccEEccccEEcccccHHHHHHHHHHHHcccEEEcccEEEEEEEEEcccccccEEEEEEEEEEEEEcccccccccHHHEEEccHHHHHccccccHHHHHHHHHHHccc //