[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57523.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   70->163 PF01292 * Ni_hydr_CYTB 0.00017 29.2 89/182  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57523.1 GT:GENE BAD57523.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2843311..2843820 GB:FROM 2843311 GB:TO 2843820 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57523.1 LENGTH 169 SQ:AASEQ MRRGPRTTAATLARWSGYGLAALPLAFAPVSVRLRVPRRWLRSPVRLERPGPLRVLAHSVLSGGSGLVGWFLALLALVALTRGLAYPVLTDDYANSWGGPTLAGAWAVHAVLGVALLPVWLLAIAGLGAVQWRLAQRLLGRTGPPWAIPLSIALAAAGALLFIAWTRQL GT:EXON 1|1-169:0| TM:NTM 4 TM:REGION 12->33| TM:REGION 57->79| TM:REGION 105->127| TM:REGION 145->166| SEG 55->69|vlahsvlsggsglvg| SEG 147->164|aiplsialaaagallfia| HM:PFM:NREP 1 HM:PFM:REP 70->163|PF01292|0.00017|29.2|89/182|Ni_hydr_CYTB| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccHHHHHHHHHccccHHHHHHHHccHHEEEEccHHHcccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcc //