[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57526.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->124 PF05331 * DUF742 2e-13 43.8 %
:HMM:PFM   13->124 PF05331 * DUF742 2.6e-32 45.9 111/114  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57526.1 GT:GENE BAD57526.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2845429..2845803) GB:FROM 2845429 GB:TO 2845803 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57526.1 LENGTH 124 SQ:AASEQ MTRGGEPWFDEAAGPVVRPYALIRGRTMGAAHDLDMLTVVVTTTAAPTLRRPEPEYGIITALCAQPKSVAEVAAHLQLPVAVTKILVGDLIGEGHLIFRAPVQPETGPGGLNVLRAVLDGIRKL GT:EXON 1|1-124:0| SEG 37->52|ltvvvtttaaptlrrp| RP:PFM:NREP 1 RP:PFM:REP 11->124|PF05331|2e-13|43.8|112/112|DUF742| HM:PFM:NREP 1 HM:PFM:REP 13->124|PF05331|2.6e-32|45.9|111/114|DUF742| OP:NHOMO 36 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----2-------------------------------2----222----------------2---1225545---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccccccccccccccEEEEccccccccccccEEEEEEEcccccccccccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHccEEEEEcccccccccccHHHHHHHHHHHHcc //