[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57527.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.7
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   23->124 1a0kA PDBj 4e-16 17.6 %
:RPS:SCOP  22->124 1skoB  d.110.7.1 * 7e-20 20.8 %
:HMM:SCOP  1->130 1j3wA_ d.110.7.1 * 1.7e-33 38.0 %
:RPS:PFM   22->98 PF03259 * Robl_LC7 8e-08 42.1 %
:HMM:PFM   9->100 PF03259 * Robl_LC7 4.4e-29 35.2 91/91  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57527.1 GT:GENE BAD57527.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2845800..2846195) GB:FROM 2845800 GB:TO 2846195 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57527.1 LENGTH 131 SQ:AASEQ MSTAKSGDLDWLLDDLVDRLAGVRHAVVLSTDGLLLGRSKAIERDDAEHFAAMSSTLYGLARSAGSRFDGGGVRQAVIELDRAVLFVTSAGDNACLALQAAENANLGMVAYEMNVTVQRVGSYLSTPARLS GT:EXON 1|1-131:0| SEG 8->20|dldwllddlvdrl| RP:PDB:NREP 1 RP:PDB:REP 23->124|1a0kA|4e-16|17.6|102/130| RP:PFM:NREP 1 RP:PFM:REP 22->98|PF03259|8e-08|42.1|76/90|Robl_LC7| HM:PFM:NREP 1 HM:PFM:REP 9->100|PF03259|4.4e-29|35.2|91/91|Robl_LC7| RP:SCP:NREP 1 RP:SCP:REP 22->124|1skoB|7e-20|20.8|101/116|d.110.7.1| HM:SCP:REP 1->130|1j3wA_|1.7e-33|38.0|129/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 110 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----4----------1111-11--1111111111116112-4352---1-----------64--575BA96---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 77.9 SQ:SECSTR ######################ccEEEEEETTccEEEEcTTcccccHHHHHHHHHHHHcTTccTTTcEEETTEEEEEEEEETTTEEEEEETTEEEEEEEcccEEETTccHHHHHHHHHHHHHHH####### DISOP:02AL 1-5, 129-131| PSIPRED ccccccHHHHHHHHHHHHHcHHHHEEEEEEccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccc //