Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57530.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57530.1 GT:GENE BAD57530.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2850166..2850489) GB:FROM 2850166 GB:TO 2850489 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57530.1 LENGTH 107 SQ:AASEQ MNGTAGRTALMMMAAATAVAVLGGCTDIERALNKGGDTPCREYVAQDPDTKRTTITKFVKERDHLENEPPGTSVDVTMVAVDVLCGAQRNAETPIKNADVAGIFFNK GT:EXON 1|1-107:0| SEG 3->24|gtagrtalmmmaaatavavlgg| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 61-71| PSIPRED ccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccEEEccc //