[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57531.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.76.1
:380 amino acids
:PSIPRED
:RPS:SCOP  62->375 1ei6A  c.76.1.4 * 1e-10 22.2 %
:HMM:SCOP  24->378 1ei6A_ c.76.1.4 * 4.9e-51 32.8 %
:RPS:PFM   71->255 PF01663 * Phosphodiest 9e-04 31.4 %
:HMM:PFM   41->365 PF01663 * Phosphodiest 2.7e-29 25.5 302/364  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57531.1 GT:GENE BAD57531.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2850630..2851772) GB:FROM 2850630 GB:TO 2851772 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57531.1 LENGTH 380 SQ:AASEQ MFAAPRYGSGSLADVLPSVLACLGVPGEEDRLGLDLTARRVCVLLIDGLGAELLAEHAEAAPFLSGLASMPLTTGFPSTTATSLSSLGVGAPPGEHGIVGYQMTVPGYDRLVNPLRWRLQGGGPEVDLLRELVPEQFQPRPTTFERAAAAGVRVTQVAPMYQANSGLTRAVLRGNEFRPGLSFGDLVDGTITALRSGERSLVYAYHGDLDTTGHVRGPSSEAWLLELGHVDRIAAAIAARLPADAALVVTADHGMVELDGTIDFDTVEPLRDGVHRLGGEPRARHVYTVDGATADVAAAWQETLGPDFAVLPRQEVIARGWFGPLVTPEIAARIGDLVVAAAGTRGVIRSAAEPLESAMIGHHGSLTTAELDVPLRIATA GT:EXON 1|1-380:0| SEG 48->61|glgaellaehaeaa| SEG 231->247|driaaaiaarlpadaal| SEG 288->299|tvdgatadvaaa| RP:PFM:NREP 1 RP:PFM:REP 71->255|PF01663|9e-04|31.4|169/308|Phosphodiest| HM:PFM:NREP 1 HM:PFM:REP 41->365|PF01663|2.7e-29|25.5|302/364|Phosphodiest| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF01663|IPR002591| RP:SCP:NREP 1 RP:SCP:REP 62->375|1ei6A|1e-10|22.2|302/404|c.76.1.4| HM:SCP:REP 24->378|1ei6A_|4.9e-51|32.8|323/406|c.76.1.4|1/1|Alkaline phosphatase-like| OP:NHOMO 68 OP:NHOMOORG 68 OP:PATTERN -----------------1-------------------------------------------11----- ---11----------11----1--11------111111111---11111111111111--111111111111111111----------------------------------------------------------111------1-------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEccccccccHHHHHHHHHHHHccccccccccccccccEEEEEEEccccHHHHHHcccccHHHHHHHccccccccccccccHHHHHHccccHHHcEEEccEEEcHHHccEEEcccccccccccccccccccccHHHccccHHHHHHHHcccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccEEEEcccHHHHcccccccccccEEEEEcccccHHHHHHHHHHHccccEEEEcHHHHHHHccccccccccHHcccccEEEEEccccEEEEEccccccHHHccccccccHHHEEccEEEEEc //