Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57534.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:HMM:PFM   15->63 PF10099 * RskA 0.00025 29.8 47/175  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57534.1 GT:GENE BAD57534.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2853663..2853923 GB:FROM 2853663 GB:TO 2853923 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57534.1 LENGTH 86 SQ:AASEQ MLVTTLVVATIGLIRKLRNRSATDRPDRPARAATGWRSVRQVARRPVPAVSAAVALAGGSVAVGHPGLVLSRSRSAIPVARRGPSR GT:EXON 1|1-86:0| SEG 20->34|rsatdrpdrparaat| SEG 38->64|svrqvarrpvpavsaavalaggsvavg| HM:PFM:NREP 1 HM:PFM:REP 15->63|PF10099|0.00025|29.8|47/175|RskA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 19-30, 83-86| PSIPRED cHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHccccEEEccccEEEEccccccccccccccc //