[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57537.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->170 2hszA PDBj 3e-05 27.6 %
:RPS:PDB   4->191 3d6jA PDBj 3e-14 20.4 %
:RPS:SCOP  4->196 2ah5A1  c.108.1.6 * 7e-22 24.2 %
:HMM:SCOP  3->190 1n8nA_ c.108.1.12 * 1.7e-32 34.6 %
:HMM:PFM   4->120 PF00702 * Hydrolase 6.8e-10 27.4 117/192  
:BLT:SWISS 5->191 GPH_YERPS 4e-10 33.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57537.1 GT:GENE BAD57537.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2855541..2856149) GB:FROM 2855541 GB:TO 2856149 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57537.1 LENGTH 202 SQ:AASEQ MSWTVGFDLDMTLIDSRPGVARAVDIAAAEFGVGVRGADIVDKLGPPMPMLLADAGMDESLIPAFVARYRELYPSVVARIPAMPGADAALAAVLDRGGRVVVVTGKHTPLAQLHLDALGWRVDALVGDLWSAAKAGALREHRARVFVGDHAGDMRGAKAAQALAVGVTTGPCDADELWAAGADVILADLTDFPAWLDEQAVA GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 5->191|GPH_YERPS|4e-10|33.0|179/232| SEG 86->99|adaalaavldrggr| BL:PDB:NREP 1 BL:PDB:REP 5->170|2hszA|3e-05|27.6|163/222| RP:PDB:NREP 1 RP:PDB:REP 4->191|3d6jA|3e-14|20.4|186/206| HM:PFM:NREP 1 HM:PFM:REP 4->120|PF00702|6.8e-10|27.4|117/192|Hydrolase| RP:SCP:NREP 1 RP:SCP:REP 4->196|2ah5A1|7e-22|24.2|190/210|c.108.1.6| HM:SCP:REP 3->190|1n8nA_|1.7e-32|34.6|159/0|c.108.1.12|1/1|HAD-like| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1----1111---------------1-1-111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 98.0 SQ:SECSTR cccEEEEcccTTTEEcHHHHHHHHHHHHHHTTcccccHHHHTTTTccHHHHHHHccccHHHHHHHHHHHHHHHHHHGGGcEEcTTHHHHHHHHHHHTcEEEEEccccHHHHHHHHHHTcccccEEEcccccTTcTHHHHHHHHHEEEEccHHHHHHHHHHTcEEEEETTccccTTGGGGccccEEEccGGGHHHHTTc#### DISOP:02AL 202-203| PSIPRED cccEEEEEccccccccHHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHcccccEEEcccccccccccccccccEEEEcccHHHHHHHHHccccEEEEccccccHHHHHHccccEEEccHHHHHHHHHHcccc //