[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57543.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.219.1
:362 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   60->97 2apoB PDBj 1e-04 28.6 %
:RPS:PDB   82->361 1a6qA PDBj 4e-05 12.2 %
:RPS:SCOP  226->361 1txoA  d.219.1.1 * 2e-09 29.8 %
:HMM:SCOP  100->363 1txoA_ d.219.1.1 * 1.4e-31 30.9 %
:HMM:PFM   197->233 PF00481 * PP2C 9.5e-05 43.8 32/257  
:HMM:PFM   308->354 PF00481 * PP2C 3.8e-05 38.3 47/257  
:HMM:PFM   52->86 PF03833 * PolC_DP2 0.0009 31.4 35/900  
:BLT:SWISS 226->358 STP1_LISW6 7e-08 35.8 %
:REPEAT 2|57->68|69->80
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57543.1 GT:GENE BAD57543.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2863681..2864769 GB:FROM 2863681 GB:TO 2864769 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57543.1 LENGTH 362 SQ:AASEQ MNPDLPQDPADVPTEPVEHRAPGATPRPAEAPTVEITAESSGLPAGHDPATRPVRRSGPRCPDCDAEVSGPRCPGCGADLDGKYVALPVPGAAADRFEADLGAVCVVTDRGIAHARNEDAVAAAVLEGEHGPHTTVIVVCDGVSTSANPQAASGTAVRAGVQACLAALRQGATAPDAAQAGLAAAADAVRAIATDDLHAPSCTYVSAVVRGAGGGAVDVTVANVGDSRAYWLAAEPFRDDPGCMPSQRLTVDDSWAQALVDAGAMDEQAAMNDPRAHTLLRWLGADSDENPWSENAVRTFRAVGPGRLLLCSDGLWNYRPEPDGLAALAAAPDPMAAARDLADFAVRSGGNDNITIALAPVS GT:EXON 1|1-362:0| BL:SWS:NREP 1 BL:SWS:REP 226->358|STP1_LISW6|7e-08|35.8|120/252| NREPEAT 1 REPEAT 2|57->68|69->80| SEG 172->196|atapdaaqaglaaaadavraiatdd| SEG 205->225|vsavvrgagggavdvtvanvg| SEG 322->343|pdglaalaaapdpmaaardlad| RP:PDB:NREP 2 RP:PDB:REP 60->97|2apoB|1e-04|28.6|35/52| RP:PDB:REP 82->361|1a6qA|4e-05|12.2|270/363| HM:PFM:NREP 3 HM:PFM:REP 197->233|PF00481|9.5e-05|43.8|32/257|PP2C| HM:PFM:REP 308->354|PF00481|3.8e-05|38.3|47/257|PP2C| HM:PFM:REP 52->86|PF03833|0.0009|31.4|35/900|PolC_DP2| RP:SCP:NREP 1 RP:SCP:REP 226->361|1txoA|2e-09|29.8|121/235|d.219.1.1| HM:SCP:REP 100->363|1txoA_|1.4e-31|30.9|233/0|d.219.1.1|1/1|PP2C-like| OP:NHOMO 10 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1----112--------------------1--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 299 STR:RPRED 82.6 SQ:SECSTR ###########################################################EcTTTccEEccccccccccccccccccccEEEEEEETEEEETTEEEEEEEEEETcccccEEEEEEEEETTTEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHTcHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccEEcEEEEEEcccEEEEEEEccEEEEEETTEEE###ETTEEEEEcccccTTcHHHHHHHHHTTccEETTEETTTccccccEEcGGcccTTccGGGccccccEEEEEcHHHHTTccHHHHHHHHTTcccHHHHHHHHHHHHHHTTccccEEEEEEEc# DISOP:02AL 1-6, 8-11, 14-16, 18-48, 85-96| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccHHcccccccccccccccccccccccccccccccccHHHHcccEEEEccccccccccccEEEEEccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccEEEEEEEcccEEEEEEccEEEcccccccEEEEcccccHHHHHHHcccccHHHHHHcccccEEEEEEcccccccccccccEEEEEEccccEEEEEcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHccccccEEEEEEEEc //