[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57545.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->104 PF12595 * Rhomboid_SP 0.00038 21.3 94/209  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57545.1 GT:GENE BAD57545.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2866363..2866680) GB:FROM 2866363 GB:TO 2866680 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57545.1 LENGTH 105 SQ:AASEQ MRAPRNTVAALLAAAALAAVGTACDEAEKAVNKGGDTPCSEFTAQDADKKRTTVTKFLEEERGEAPADQNTLDLAIAAIDLMCSAQADPDTPIRQADLTGVLVPK GT:EXON 1|1-105:0| SEG 9->19|aallaaaalaa| HM:PFM:NREP 1 HM:PFM:REP 8->104|PF12595|0.00038|21.3|94/209|Rhomboid_SP| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 61-65| PSIPRED ccccHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccccEEEccc //