[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57546.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->50 PF10099 * RskA 0.00035 27.3 44/175  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57546.1 GT:GENE BAD57546.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2866711..2867172) GB:FROM 2866711 GB:TO 2867172 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57546.1 LENGTH 153 SQ:AASEQ MTAPSPRRRAFSALPLAAACALLAACGNALETDQPAVPATPTDPGFEMTIAPPSSSVTDVPDPDRISPEAATALCDTIRADLDSWRDQGSIIARVSFNGAVHNWAVRNGGLNDAVVRDRSVVDTATTAQCPDVRDQALEVLDVPDLAAALAGF GT:EXON 1|1-153:0| SEG 13->30|alplaaacallaacgnal| SEG 52->64|ppsssvtdvpdpd| SEG 137->151|alevldvpdlaaala| HM:PFM:NREP 1 HM:PFM:REP 6->50|PF10099|0.00035|27.3|44/175|RskA| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------3-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 48-61| PSIPRED cccccHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccEEcccccccccccHHHHcccEEEEcccccccHHHHHHHHHHHccccHHHHHHcc //