[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57547.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   41->90 PF07332 * DUF1469 1.7e-05 22.0 50/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57547.1 GT:GENE BAD57547.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2867219..2867530) GB:FROM 2867219 GB:TO 2867530 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57547.1 LENGTH 103 SQ:AASEQ MMSAQSHSPQHGDFPDHARTMRSHAGEAIEDTRNWPGMILVGLGIVTVGLTLVAAGYGFEGWAIIGGIAAALFLIVGAVLILAEHRRVQKLSDRNSGFDDRGH GT:EXON 1|1-103:0| TM:NTM 2 TM:REGION 36->58| TM:REGION 64->85| SEG 63->83|aiiggiaaalflivgavlila| HM:PFM:NREP 1 HM:PFM:REP 41->90|PF07332|1.7e-05|22.0|50/121|DUF1469| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14, 90-103| PSIPRED cccccccccccccccHHHHHHHHHccHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //