[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57549.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->69 PF04972 * BON 5.5e-11 28.3 60/64  
:BLT:SWISS 11->59 LOX2_ARATH 2e-04 36.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57549.1 GT:GENE BAD57549.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2868356..2868619) GB:FROM 2868356 GB:TO 2868619 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57549.1 LENGTH 87 SQ:AASEQ MDKPQYQVAHLRRALAEDPRTAELGVQVTIRGDVVVLDGEVASETLKEQMTAVVREQLPQLRVHNDVRVVHPAAPAGAEHLSTPERS GT:EXON 1|1-87:0| BL:SWS:NREP 1 BL:SWS:REP 11->59|LOX2_ARATH|2e-04|36.7|49/100| HM:PFM:NREP 1 HM:PFM:REP 10->69|PF04972|5.5e-11|28.3|60/64|BON| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------1---------------------------11----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 79-87| PSIPRED cccHHHHHHHHHHHHHccccccccEEEEEEEEcEEEEEcccccHHHHHHHHHHHHHHccccEEcccEEEEEccccccHHHccccccc //