[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57550.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:191 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  6->152 2ewrA1  d.218.1.11 * 2e-17 16.9 %
:HMM:SCOP  3->148 2fclA1 d.218.1.11 * 1e-28 33.6 %
:HMM:PFM   10->51 PF09970 * DUF2204 0.00021 33.3 42/184  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57550.1 GT:GENE BAD57550.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2868626..2869201) GB:FROM 2868626 GB:TO 2869201 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57550.1 LENGTH 191 SQ:AASEQ MVATMDELLHALTRAVNALSESDVRFAVAGGCAVYARGGPASDHDVDLFVKPEDASRAVQVLTRAGLRGCDPAEDWLKKVYDRDTLIDIIYRPNCRDVTDELLDRAETMRIGPAVAPVVSATDLMVDKLLVFDAHRLDLSPLLHIARDLREQVDWPQVRAETIHSPYAKAFLGLIDDLGIADTRADMKKAG GT:EXON 1|1-191:0| HM:PFM:NREP 1 HM:PFM:REP 10->51|PF09970|0.00021|33.3|42/184|DUF2204| RP:SCP:NREP 1 RP:SCP:REP 6->152|2ewrA1|2e-17|16.9|142/156|d.218.1.11| HM:SCP:REP 3->148|2fclA1|1e-28|33.6|146/0|d.218.1.11|1/1|Nucleotidyltransferase| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------111----1---1-------1111-1--111----------------11--111-1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1-------------------11-----------------------------------------------------------------------------------------------------------------1---------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 188-191| PSIPRED ccccHHHHHHHHHHHHHHHHHHcccEEHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHccccccccccccEEEEccccEEEEEEEccccccccHHHHHHHHcccccHHHccEEcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcc //