[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57551.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.239.1
:142 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  12->71 1sg7A1  a.239.1.1 * 8e-10 35.0 %
:HMM:SCOP  10->73 1sg7A1 a.239.1.1 * 8.9e-15 45.3 %
:RPS:PFM   17->71 PF06150 * ChaB 3e-05 43.6 %
:HMM:PFM   17->72 PF06150 * ChaB 3.1e-21 44.6 56/57  
:HMM:PFM   105->133 PF07498 * Rho_N 7.6e-07 37.9 29/43  
:BLT:SWISS 17->71 Y060_NPVOP 2e-04 30.9 %
:REPEAT 2|2->13|16->27

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57551.1 GT:GENE BAD57551.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2869308..2869736 GB:FROM 2869308 GB:TO 2869736 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57551.1 LENGTH 142 SQ:AASEQ MEMPKTTRTGEAKKSELPSTLRRSEEKAQRTFAKAHDAALAEYGSEERAYRVGYSALKHSYEKVGDHWEAKEQRGPSDERAEHGGPDAEGETAGGVNANASKKHLLDVAGRLGITGRWKMTKHQLISAIEKENRRETARARS GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 17->71|Y060_NPVOP|2e-04|30.9|55/90| NREPEAT 1 REPEAT 2|2->13|16->27| RP:PFM:NREP 1 RP:PFM:REP 17->71|PF06150|3e-05|43.6|55/57|ChaB| HM:PFM:NREP 2 HM:PFM:REP 17->72|PF06150|3.1e-21|44.6|56/57|ChaB| HM:PFM:REP 105->133|PF07498|7.6e-07|37.9|29/43|Rho_N| RP:SCP:NREP 1 RP:SCP:REP 12->71|1sg7A1|8e-10|35.0|60/75|a.239.1.1| HM:SCP:REP 10->73|1sg7A1|8.9e-15|45.3|64/0|a.239.1.1|1/1|ChaB-like| OP:NHOMO 29 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- --------------111----1---1-------1111-22-11-1--1-11-11-1----11--11----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16, 70-93, 132-142| PSIPRED ccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcEEEcccEEEEccccccccHHHHHcccccccccccccccccHHHHHHHHHHHcccccccHHcHHHHHHHHHHHHHHHHHHccc //