[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57552.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->156 PF05231 * MASE1 0.00033 22.0 109/299  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57552.1 GT:GENE BAD57552.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2869723..2870220 GB:FROM 2869723 GB:TO 2870220 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57552.1 LENGTH 165 SQ:AASEQ MRVPDDAWNRVARGETETERLDRNWNSLVQELRVVQTGVQFLVGALLIVPFQAGFAELSDRERAVYLATVAAAFGATVLLVAPVSWHRILFRRHRLANVVAAAHRCAIAGLALLGVALVGSLVLVVDIVVHPAAGSAAGALVAVSFLIAWLISPWRWRGPGRRAG GT:EXON 1|1-165:0| TM:NTM 4 TM:REGION 32->54| TM:REGION 66->88| TM:REGION 102->124| TM:REGION 134->155| SEG 109->130|aglallgvalvgslvlvvdivv| SEG 133->147|aagsaagalvavsfl| SEG 154->163|pwrwrgpgrr| HM:PFM:NREP 1 HM:PFM:REP 48->156|PF05231|0.00033|22.0|109/299|MASE1| OP:NHOMO 32 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------111-------11------21112132-21111------111-------1----121----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-19, 161-165| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccc //