[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57556.1
DDBJ      :             putative transcription antitermination regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.3d.243.1
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   40->130 3eehA PDBj 2e-04 18.9 %
:RPS:SCOP  41->130 1tfoA1  d.243.1.1 * 8e-06 5.9 %
:HMM:SCOP  27->130 1n9lA_ d.110.3.6 * 1.7e-13 26.5 %
:RPS:PFM   137->196 PF03861 * ANTAR 1e-06 41.1 %
:HMM:PFM   147->196 PF03861 * ANTAR 1.1e-18 32.0 50/56  
:HMM:PFM   39->124 PF08447 * PAS_3 8.3e-14 26.7 86/91  
:BLT:SWISS 59->179 Y1796_MYCLE 2e-17 38.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57556.1 GT:GENE BAD57556.1 GT:PRODUCT putative transcription antitermination regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2874607..2875287 GB:FROM 2874607 GB:TO 2875287 GB:DIRECTION + GB:PRODUCT putative transcription antitermination regulator GB:PROTEIN_ID BAD57556.1 LENGTH 226 SQ:AASEQ MTESGSVSPGEAGTRDRVVGAGAPRDVGSFRFRFADQRWEWSDEVAAMHGYPPGSVVPTTELLLSHKHPEDRDQVAATLARAIRDAAPFSSRHRIVDTAGRVRHVIVVADRMTDASGRAIGTAGYYIDVTGTLAAHRRETLDDTLPELYAARAVIEQAKGVLMFVYGIGAEQAFRVLSWRSQETNTKVRALAAQLLADIGDVSVPVGVRSHFDHLLLTAHERIGKD GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 59->179|Y1796_MYCLE|2e-17|38.0|121/137| SEG 76->87|aatlarairdaa| RP:PDB:NREP 1 RP:PDB:REP 40->130|3eehA|2e-04|18.9|90/116| RP:PFM:NREP 1 RP:PFM:REP 137->196|PF03861|1e-06|41.1|56/56|ANTAR| HM:PFM:NREP 2 HM:PFM:REP 147->196|PF03861|1.1e-18|32.0|50/56|ANTAR| HM:PFM:REP 39->124|PF08447|8.3e-14|26.7|86/91|PAS_3| RP:SCP:NREP 1 RP:SCP:REP 41->130|1tfoA1|8e-06|5.9|85/103|d.243.1.1| HM:SCP:REP 27->130|1n9lA_|1.7e-13|26.5|102/109|d.110.3.6|1/1|PYP-like sensor domain (PAS domain)| OP:NHOMO 45 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- --------------233----31121-----113334151-------------22-------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 39.8 SQ:SECSTR #######################################EEcTHHHHHHcccHHHHHHcGGGGGGGccHHHHHHHHHHHHHHHTTc#cEEEEEEEcGGGTTcEEEEEEEEEEEcTTccEEEEEEEEEEcc################################################################################################ DISOP:02AL 7-17, 224-226| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccEEEEcHHHHHHHcccHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEEEcccccEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccc //