[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57559.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->49 PF04440 * Dysbindin 0.00069 34.8 23/147  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57559.1 GT:GENE BAD57559.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2876644..2876826) GB:FROM 2876644 GB:TO 2876826 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57559.1 LENGTH 60 SQ:AASEQ MERGNTKHGPVADEELAHELEGTLRGNRSSRAEEWRDPEPPADDDDPAADRVERTELDTE GT:EXON 1|1-60:0| SEG 31->54|raeewrdpeppaddddpaadrver| HM:PFM:NREP 1 HM:PFM:REP 27->49|PF04440|0.00069|34.8|23/147|Dysbindin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 24-42, 56-60| PSIPRED cccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccc //