[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57570.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:366 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->50 3bioB PDBj 2e-04 38.8 %
:RPS:PDB   6->38 1dapA PDBj 4e-04 27.3 %
:RPS:PDB   140->362 3b9tB PDBj 2e-17 14.9 %
:HMM:SCOP  1->112 1nvmB1 c.2.1.3 * 1.2e-08 35.3 %
:RPS:PFM   9->49 PF01113 * DapB_N 6e-07 63.4 %
:HMM:PFM   5->67 PF01113 * DapB_N 4.8e-11 41.9 62/124  
:BLT:SWISS 2->49 DAPB_ANASP 8e-06 45.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57570.1 GT:GENE BAD57570.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2892619..2893719 GB:FROM 2892619 GB:TO 2893719 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57570.1 LENGTH 366 SQ:AASEQ MIPTLVWGTGNVGRASIRAVDAHPDLELAAVLVRDPAKSGRDAGQLAGLDRTLGVTATDDVDAALAARPRAVVYAASGDLRPDDALADVLRLLRAGAVVVTPSLYALYDPVGAPAEIRDPVLAAIEEGGGALFVSGVDPGWGNDVLPLLVSGLAGTVETVRCQEIFDYTTYDQPDSVRYLVGMGQPMDYAPPMLAAGVPTMVWGGQVRLLARALGVELDDLRETLERRPLEHTVRTELMGEFAAGTQGAVRFEVQGIVDGEPRLVIEHVTRIHPDCAPDWPSPPDGGAGAHRVIVTGMPRIEVTVAADDEHGNRSAGGNATAAGRLVNAIDWLVEAGPGLYDALTVPLRPALGKLGRTPGEQGRKQ GT:EXON 1|1-366:0| BL:SWS:NREP 1 BL:SWS:REP 2->49|DAPB_ANASP|8e-06|45.8|48/278| SEG 52->67|tlgvtatddvdaalaa| SEG 79->100|dlrpddaladvlrllragavvv| BL:PDB:NREP 1 BL:PDB:REP 2->50|3bioB|2e-04|38.8|49/281| RP:PDB:NREP 2 RP:PDB:REP 6->38|1dapA|4e-04|27.3|33/320| RP:PDB:REP 140->362|3b9tB|2e-17|14.9|208/404| RP:PFM:NREP 1 RP:PFM:REP 9->49|PF01113|6e-07|63.4|41/123|DapB_N| HM:PFM:NREP 1 HM:PFM:REP 5->67|PF01113|4.8e-11|41.9|62/124|DapB_N| GO:PFM:NREP 3 GO:PFM GO:0008839|"GO:dihydrodipicolinate reductase activity"|PF01113|IPR000846| GO:PFM GO:0009089|"GO:lysine biosynthetic process via diaminopimelate"|PF01113|IPR000846| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01113|IPR000846| HM:SCP:REP 1->112|1nvmB1|1.2e-08|35.3|102/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 108 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ----1---------28722-2B--6422222199993222---2------------------1------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1-------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 70.2 SQ:SECSTR #EEEEEEcccHHHHHHHHHHTTcccEEEEEEEEcccccccccGGGccccc#########################################################################################EEcTTccccEETTcEEEEEEccTTGGGcHHTTTcHHHHHHHcccccccccccccccTcTTcTTTTc#ccEEEEEEEETTccTTcEEEEEEEEEEEcccccGGGTTEEEEEEEEcTTcTTGG######GcccccccccEEEEEEEETTccccEEEEEEE####EEcccEEcTTccEEcccccTTccccTTcc####cccccTTTTccEEcccEEEEEEcccccc#### DISOP:02AL 358-366| PSIPRED ccEEEEEcccHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHcccccccEEEcccHHHHHcccccEEEEEcccccccHHHHHHHHHHHHccccEEEcccccEEccccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHcccEEEEEEEEEEEEEccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccEEEcEEEEEEEEEccccccccEEEEEcccEEEEEEEEEEEEEccEEEEEEEEEEcccHHHcccccccccccccEEEEEEEEcccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHccccccccccccccccccccc //