[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57572.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   61->201 1fnhA PDBj 5e-04 30.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57572.1 GT:GENE BAD57572.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2894209..2894895) GB:FROM 2894209 GB:TO 2894895 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57572.1 LENGTH 228 SQ:AASEQ MSFEYVVVPVGAVRTPGEIPDYLRSQAGRPLDDDLRLVVVAGLRAWNSAVSGSRPHAGVRIEAAGYAVRVTAADRGGPRVPGALDNAAAPVRQLLEDLITGFDYELYDARSYTVSRAPEHRVVEVDIGGEQRFSSMTERQIHGWIPNLDTLAATPFLIAGKPHDDQTFIQTYRNSAVDYTLEVHHSGRPDHYFATTLSDPALVARLIWEWAGDDWSTLERVDWLRESK GT:EXON 1|1-228:0| BL:PDB:NREP 1 BL:PDB:REP 61->201|1fnhA|5e-04|30.1|136/269| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 59.6 SQ:SECSTR ############################################################ccccEEEEEEEEccccccEEEEcTTccEEEEcccc##TTcEEEEEEEEEETTEEcc#cEEEEEcccccEEEEEEEEcccEEEEEEcccccc##ccEEEEEEEccccccEEEccTTccEEEEEcccTTcEEEEEEEEEETTE########################### DISOP:02AL 226-228| PSIPRED ccccEEEEcccccccHHHHHHHHHHHccccccccccEEEHHHHHHHHHHHHcccccccccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHcccccEEEccHHHEEEcccccEEEEEEEccccccHHHHHHHHHHHcccHHHcccccEEEEEcccccHHHHHHHccccEEEEEEEEcccccccEEEEEEccHHHHHHHHHHHccccHHHHHHHHHHHccc //