[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57573.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57573.1 GT:GENE BAD57573.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2895028..2895483) GB:FROM 2895028 GB:TO 2895483 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57573.1 LENGTH 151 SQ:AASEQ MVARPGTGAVAVNRAGGLVSPAPGPGPLPGPRGAGRGPAWRGREFGVGGAVREVLAGVGVCLLVAAVLAFVFAGTWYATRPPGPRGTAGRRMIDGGLALAALGVCVAVAGLLPVRSPGSPETLPTATTVAPTAPAANHPGDMASGAQPSPR GT:EXON 1|1-151:0| TM:NTM 2 TM:REGION 53->74| TM:REGION 94->115| SEG 15->43|agglvspapgpgplpgprgagrgpawrgr| SEG 54->74|vlagvgvcllvaavlafvfag| SEG 78->91|atrppgprgtagrr| SEG 95->114|gglalaalgvcvavagllpv| SEG 120->139|petlptattvaptapaanhp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 30-32, 140-151| PSIPRED ccccccccEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc //