[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57575.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->71 PF02069 * Metallothio_Pro 0.00014 20.7 29/52  
:HMM:PFM   2->36 PF06467 * zf-FCS 0.00012 20.0 35/43  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57575.1 GT:GENE BAD57575.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2896948..2897190 GB:FROM 2896948 GB:TO 2897190 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57575.1 LENGTH 80 SQ:AASEQ MSRMAVCDTCGNDYDKAFTVTRDGHTATFDSIECAAAAIAPVCAHCSCRILGHGVEAGEQIFCCAHCAHKAGHPQLVDHA GT:EXON 1|1-80:0| SEG 34->46|caaaaiapvcahc| HM:PFM:NREP 2 HM:PFM:REP 43->71|PF02069|0.00014|20.7|29/52|Metallothio_Pro| HM:PFM:REP 2->36|PF06467|0.00012|20.0|35/43|zf-FCS| OP:NHOMO 29 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ----1---------111----1---1------11111------1----------1-----11---11---------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------------------------1121-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 73-80| PSIPRED cccccEEEEcccccccEEEEEEcccHHHHHHHHHHHHHHcccccccEEEEEEEccccccEEEEccHHccccccccccccc //