[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57576.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  50/68 : Bacteria  392/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.18.1
:211 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->208 1ui0A PDBj 6e-31 40.4 %
:RPS:PDB   31->210 2d07A PDBj 2e-36 16.2 %
:RPS:SCOP  19->202 1l9gA  c.18.1.2 * 4e-37 35.2 %
:HMM:SCOP  12->208 1l9gA_ c.18.1.2 * 8.6e-54 40.7 %
:RPS:PFM   46->179 PF03167 * UDG 9e-16 40.5 %
:HMM:PFM   43->199 PF03167 * UDG 8.7e-44 44.5 146/150  
:BLT:SWISS 44->194 DPOL_BPSP1 1e-06 30.2 %
:REPEAT 2|5->86|113->193

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57576.1 GT:GENE BAD57576.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2897222..2897857) GB:FROM 2897222 GB:TO 2897857 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57576.1 LENGTH 211 SQ:AASEQ MAAAKAPGAAEFVPADADLDTLRTAVQGCRGCELYRGATQAVFGEGPAHAPVFVVGEQPGDREDVAGHPFVGPAGRLLDKALTEADIDREAVYLTNAVKHFKFEERGKRRIHKQPGRTEVVACSPWLTAELDAVRPQLVVCLGAVAAKAVLGPSFKVSERRGEVVEAGEHRVIATVHPSSVLRAPDRAAAYADFLADLRKVRTAAGELHRA GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 44->194|DPOL_BPSP1|1e-06|30.2|139/100| NREPEAT 1 REPEAT 2|5->86|113->193| BL:PDB:NREP 1 BL:PDB:REP 19->208|1ui0A|6e-31|40.4|183/192| RP:PDB:NREP 1 RP:PDB:REP 31->210|2d07A|2e-36|16.2|179/215| RP:PFM:NREP 1 RP:PFM:REP 46->179|PF03167|9e-16|40.5|121/147|UDG| HM:PFM:NREP 1 HM:PFM:REP 43->199|PF03167|8.7e-44|44.5|146/150|UDG| RP:SCP:NREP 1 RP:SCP:REP 19->202|1l9gA|4e-37|35.2|176/191|c.18.1.2| HM:SCP:REP 12->208|1l9gA_|8.6e-54|40.7|189/191|c.18.1.2|1/1|Uracil-DNA glycosylase-like| OP:NHOMO 575 OP:NHOMOORG 443 OP:PATTERN 11111111111111111121111121111111--------------1-11111-11111112--1111 12211----------11--------1-----112121-11211-1-----------------1--12-1---------1111311111--------------------1----------------11-1111111111111111111-11---11111111-1--111111111111111111-1111111---1111111111111111-----111-----------------------------------11-----1111--11-------------------------------------------------------1--2-2222222-2-3-221----22--1---2111111111111111--112122211111212221222121211111111112-22222122321-122233234322311111222222211111111111223212111111111111111111111111111111111--1111122221222111122332222111232221--11111-------1-11121-111-------112221-1-1-1----------1-111111222232121-------------------1-11111---------------------------------2111--------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------1-12122111------11--1111--------11--------------------------1111111111132 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------6------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 99.1 SQ:SECSTR #cccccccccccccccHHHHHHHHHTTTTccccccccccEEccccccTTccEEEEEccccHHHHHHTcccccccccHHHHHHHHTTcccccccGGGGGGHHHHHcEEEcEEcccccHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHTccccccccccTTcccEEEEEccccTTccccccGGGTHHHHHHHHHHHHHHHTccc# DISOP:02AL 1-10, 209-211| PSIPRED ccccccccccHHccccccHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHcccccHHEEccEEEEcccEEEEEEEccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcc //