[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57578.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->88 3b8lB PDBj 2e-07 40.0 %
:RPS:PDB   7->133 3b8lB PDBj 7e-28 24.0 %
:RPS:SCOP  7->133 3b8lA1  d.17.4.28 * 8e-32 30.1 %
:HMM:SCOP  3->134 3stdA_ d.17.4.1 * 1.8e-35 37.9 %
:HMM:PFM   15->90 PF07366 * SnoaL 2.1e-06 21.9 73/126  
:BLT:SWISS 1->137 Y2934_MYCBO 2e-34 49.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57578.1 GT:GENE BAD57578.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2899058..2899501) GB:FROM 2899058 GB:TO 2899501 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57578.1 LENGTH 147 SQ:AASEQ MLSLQEISDRMEIEDLMVRYAHAIDTHQWDLLDDLFTADAHIDYTAMGGPAGDLAATKQFLATALPNFPAFQHLISNSALTIDGDTATGRTMCQNPMLVGGPDGPQQLMLCGLWYLDTFARIDGRWRIRSRVEEKSYMFLAGSAVTS GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 1->137|Y2934_MYCBO|2e-34|49.6|135/147| BL:PDB:NREP 1 BL:PDB:REP 7->88|3b8lB|2e-07|40.0|80/137| RP:PDB:NREP 1 RP:PDB:REP 7->133|3b8lB|7e-28|24.0|121/137| HM:PFM:NREP 1 HM:PFM:REP 15->90|PF07366|2.1e-06|21.9|73/126|SnoaL| RP:SCP:NREP 1 RP:SCP:REP 7->133|3b8lA1|8e-32|30.1|123/144|d.17.4.28| HM:SCP:REP 3->134|3stdA_|1.8e-35|37.9|132/0|d.17.4.1|1/1|NTF2-like| OP:NHOMO 54 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- ----1---------13211-13--131111113333112----1------------------1----11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------14----------1-----------------3----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 89.1 SQ:SECSTR ##cTccHHHHHHHHHHHHHHHHHHTTccHHHHHTTEEEEEEEEcGGGTccEEHHHHHHHHHHHHHHHEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEETTccEcEEEEEEEEEEEEEEETTEEEEEEEEE############## DISOP:02AL 1-2, 144-147| PSIPRED cccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHcccccEEEEEccEEEEEEccEEEEEEEEEEEEEEEccccccEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEcccccccc //