[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57580.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->56 PF12343 * DEADboxA 2.1e-05 40.0 35/63  
:REPEAT 2|17->34|38->55

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57580.1 GT:GENE BAD57580.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2900861..2901118 GB:FROM 2900861 GB:TO 2901118 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57580.1 LENGTH 85 SQ:AASEQ MQMHVHRNPAPTTGFADGSPEPRCRTGSGTGEWRDVRDGTNRPRHDGAAGWGEIRRHLIRVATRRGTDRGASYGGSSWLIADPTT GT:EXON 1|1-85:0| NREPEAT 1 REPEAT 2|17->34|38->55| HM:PFM:NREP 1 HM:PFM:REP 22->56|PF12343|2.1e-05|40.0|35/63|DEADboxA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED cccccccccccccccccccccccEEcccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccEEEEEcccc //