[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57585.1
DDBJ      :             putative sigma factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  152/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13d.17.4
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->59 1h3lB PDBj 4e-05 50.0 %
:RPS:PDB   16->155 3dxjF PDBj 2e-10 12.1 %
:RPS:PDB   176->290 3dm8A PDBj 4e-10 13.9 %
:RPS:SCOP  15->69 1h3lA  a.177.1.1 * 5e-09 40.7 %
:RPS:SCOP  176->290 3dm8A1  d.17.4.20 * 1e-10 13.9 %
:HMM:SCOP  13->95 1or7A2 a.177.1.1 * 3.2e-11 24.7 %
:HMM:SCOP  108->175 1or7A1 a.4.13.2 * 8e-09 25.0 %
:HMM:SCOP  175->290 1qjgA_ d.17.4.3 * 1.1e-10 31.8 %
:RPS:PFM   19->71 PF04542 * Sigma70_r2 5e-04 39.6 %
:HMM:PFM   13->75 PF04542 * Sigma70_r2 7.4e-16 38.1 63/71  
:HMM:PFM   118->169 PF08281 * Sigma70_r4_2 1.5e-11 28.8 52/54  
:PROS 239->247|PS00221|MIP
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57585.1 GT:GENE BAD57585.1 GT:PRODUCT putative sigma factor GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2904788..2905681) GB:FROM 2904788 GB:TO 2905681 GB:DIRECTION - GB:PRODUCT putative sigma factor GB:PROTEIN_ID BAD57585.1 LENGTH 297 SQ:AASEQ MTDPHLAAVIGERRQLINLAYRLLGSLAEAEDVVQETYARWYALSERQRREVTAPGAWMTTVAGRICLDLLGSARARRERYVGEWIPEPVPGRPEWLGGSGPGDPADRVTLDESIGMAFLVVLDAMTPAERVAFVLHDVFRYSFPEVAEIVGRSPAACRQLASSARRRLRTARGPSTAERADVVRDFKRAWEAGDVRALIRVLDPQAIATADSGGLVPAFLEPIHGGAQIARAWIEIAARNPAVTLAEHRVNGQPGLVGHLDGRIVTVYAFDIADHRITRIWAVRNPEKLRHWHTVR GT:EXON 1|1-297:0| PROS 239->247|PS00221|MIP|PDOC00193| SEG 156->173|aacrqlassarrrlrtar| BL:PDB:NREP 1 BL:PDB:REP 15->59|1h3lB|4e-05|50.0|44/78| RP:PDB:NREP 2 RP:PDB:REP 16->155|3dxjF|2e-10|12.1|132/349| RP:PDB:REP 176->290|3dm8A|4e-10|13.9|115/135| RP:PFM:NREP 1 RP:PFM:REP 19->71|PF04542|5e-04|39.6|53/70|Sigma70_r2| HM:PFM:NREP 2 HM:PFM:REP 13->75|PF04542|7.4e-16|38.1|63/71|Sigma70_r2| HM:PFM:REP 118->169|PF08281|1.5e-11|28.8|52/54|Sigma70_r4_2| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| RP:SCP:NREP 2 RP:SCP:REP 15->69|1h3lA|5e-09|40.7|54/75|a.177.1.1| RP:SCP:REP 176->290|3dm8A1|1e-10|13.9|115/135|d.17.4.20| HM:SCP:REP 13->95|1or7A2|3.2e-11|24.7|81/113|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 108->175|1or7A1|8e-09|25.0|68/68|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| HM:SCP:REP 175->290|1qjgA_|1.1e-10|31.8|110/125|d.17.4.3|1/1|NTF2-like| OP:NHOMO 321 OP:NHOMOORG 153 OP:PATTERN -------------------------------------------------------------------- -11-G---------66633-34--353333216444815413261B-1------------523-1157H6------------1--------------------------1----------------------------------1-1-------------------1---------------------------111111-1-111111-111--111-------------14--------------------------------------------------------------------------------------------------------------------------------------------2--1111-------1---111--1-----------1-121-12-1-11-1---111111111------11-11-1--------------1----------------------------------11--111-122221-11111122111111211-1-1--11----111-1-1-----------------------------------------------723333--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------22----------------11---------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 253 STR:RPRED 85.2 SQ:SECSTR ##############HHHHHHGGGccccccHHHHHHHHHHHHHHHHcccTTccccHHHHHHHHHHHHHHHHH##HHHcccccccHHHHHHHHHHHH######HHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccc###################ccccHHHHHHHHHHHHHHHcccHHHHHHEEEEEEEEEEccTTTcTTcEEEEcHHHHHHHHHHHHHHEEEEEEEEEEEcccEEEEEETTccEEEEEEEEEETTEEEEEEEEEcHHHHHHHH### DISOP:02AL 168-181, 295-297| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHccccccEEEEEEEccccEEEEEEcccEEEEEEEEEEccEEEEEEEEEcHHHHHHccccc //