[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57587.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->151 3f7sA PDBj 8e-13 36.4 %
:RPS:PDB   8->137 3ebyA PDBj 2e-09 12.3 %
:RPS:SCOP  7->135 1hkxA  d.17.4.7 * 1e-12 16.4 %
:HMM:SCOP  1->140 1hkxA_ d.17.4.7 * 1e-21 28.3 %
:HMM:PFM   25->91 PF07366 * SnoaL 8.5e-06 30.8 65/126  
:PROS 119->130|PS00213|LIPOCALIN

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57587.1 GT:GENE BAD57587.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2906378..2906833 GB:FROM 2906378 GB:TO 2906833 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57587.1 LENGTH 151 SQ:AASEQ MNHAHPTEHSAAAHAELRRRIDEAVDALRTKDLAALERLYTPDVVSFDIEPPLQHVGIAAKLANWARVFEVFDTVTYEVRDLTFTAGADVAFGHAFARLGGTRADGTATSGIWVRVSYGLRRIDGAWLIAHDQVSVPLDIRTGRGVVDLEP GT:EXON 1|1-151:0| PROS 119->130|PS00213|LIPOCALIN|PDOC00187| BL:PDB:NREP 1 BL:PDB:REP 10->151|3f7sA|8e-13|36.4|132/134| RP:PDB:NREP 1 RP:PDB:REP 8->137|3ebyA|2e-09|12.3|130/151| HM:PFM:NREP 1 HM:PFM:REP 25->91|PF07366|8.5e-06|30.8|65/126|SnoaL| RP:SCP:NREP 1 RP:SCP:REP 7->135|1hkxA|1e-12|16.4|128/140|d.17.4.7| HM:SCP:REP 1->140|1hkxA_|1e-21|28.3|138/0|d.17.4.7|1/1|NTF2-like| OP:NHOMO 41 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ---------------------1----------11111--1-----1-1------------11-----------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------11111111-------------------------------------------------------------------------------------------------------1------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1--1-----------------------------11111111111111---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 96.7 SQ:SECSTR #####HHcHHHHHHHHHHHHHHHHHHHHHTTcGGGTGGGEEEEEEEEEEEGGGGGcccccEEEEccHHHHHHHHHHHHTccEEEEEETTEEEEEEEEEEEEEcTTccEEEEEEEEEEEEEEccTTccEEEEEEEEEcEEHHHHHHHHHccc DISOP:02AL 1-11| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHcccccEEEEEEEEEEEEccEEEEEEEEEccccccccccccEEEEEEEEEEEEEccEEEEEEEEcccccccccccEEEEEcc //