[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57593.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:206 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   146->182 PF11066 * DUF2867 2e-04 55.6 %
:HMM:PFM   17->183 PF11066 * DUF2867 4.7e-37 35.9 145/149  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57593.1 GT:GENE BAD57593.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2910600..2911220 GB:FROM 2910600 GB:TO 2911220 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57593.1 LENGTH 206 SQ:AASEQ MSSRLPRAAHTERPWRIHEIAPEFHLQDVWAFRAPGAGPNDFASARKLLPGGDGTESGSAAVRFLFAVRWRLGALLGWDDPRTGLGTRVRSLRDRLPDDLRPDPAETATPDSPFTTLYELHDEAALELANRTVHGIAHFGWVPVRDGYELRMAVLVQPNGRFGRWYLAAIEPFRLLIVYPGMLRRWDRQWRQRLSGSRAVTPGEVR GT:EXON 1|1-206:0| SEG 92->104|lrdrlpddlrpdp| SEG 183->194|lrrwdrqwrqrl| RP:PFM:NREP 1 RP:PFM:REP 146->182|PF11066|2e-04|55.6|36/140|DUF2867| HM:PFM:NREP 1 HM:PFM:REP 17->183|PF11066|4.7e-37|35.9|145/149|DUF2867| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1-11--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 204-206| PSIPRED ccccccccccccccEEHHHcccHHHHHHHHHccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccEEEEEEEEcccccccEEEEEEcccEEEEEEccHHHHHHHHHHHHHHcccccccccccc //