[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57594.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->103 PF01794 * Ferric_reduct 0.00029 25.0 44/125  
:BLT:SWISS 92->115 QOX1_ACEAC 2e-04 62.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57594.1 GT:GENE BAD57594.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2911217..2911615 GB:FROM 2911217 GB:TO 2911615 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57594.1 LENGTH 132 SQ:AASEQ MITWAGRLIVLFGAAHTILALTLMRAASHAGDWFSGALWRDDLADMSPANSALWLSLNSFGIPLVLVGLTVLWLDRRGITPPRFLAWVLGLWTAQCAVILILTPWPIMAVAVGLLVAGSRRAAPTPQPTTAV GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 92->115|QOX1_ACEAC|2e-04|62.5|24/100| TM:NTM 3 TM:REGION 4->26| TM:REGION 54->75| TM:REGION 90->112| HM:PFM:NREP 1 HM:PFM:REP 4->103|PF01794|0.00029|25.0|44/125|Ferric_reduct| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 126-132| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHEEEEEEcccHHHHHHHHHHHcccccccccccccccc //