[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57596.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->67 PF09535 * Gmx_para_CXXCG 0.00023 29.2 48/237  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57596.1 GT:GENE BAD57596.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2912158..2912511) GB:FROM 2912158 GB:TO 2912511 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57596.1 LENGTH 117 SQ:AASEQ MSMPSAETNACEPTEVDPSSAGSSALPDHYPHQDLPKLPTRRTHNQSMAATLRLWHTRNRELLERVAVGLRHLDQPRACQNTDPVRGRAHAIHLMAEHVRHGCRRFQLAAQYIEDSQ GT:EXON 1|1-117:0| HM:PFM:NREP 1 HM:PFM:REP 19->67|PF09535|0.00023|29.2|48/237|Gmx_para_CXXCG| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-25, 114-117| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //