[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57597.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:485 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   40->83 3bdnA PDBj 3e-05 15.9 %
:RPS:SCOP  43->83 1xwrA1  a.35.1.9 * 7e-05 17.1 %
:HMM:SCOP  43->83 1x57A1 a.35.1.12 * 0.0003 24.4 %
:HMM:PFM   54->84 PF01381 * HTH_3 4.9e-05 25.8 31/55  
:BLT:SWISS 52->205 METE_MYCPA 3e-05 32.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57597.1 GT:GENE BAD57597.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2912551..2914008 GB:FROM 2912551 GB:TO 2914008 GB:DIRECTION + GB:PRODUCT putative DNA-binding protein GB:PROTEIN_ID BAD57597.1 LENGTH 485 SQ:AASEQ MVARIAVTIDSSFAVLSGWKERPRLHRTRTLAVPQRRGERRGMTIIKWTGREVAALRTALRDTQIQFADRIGCSLEAVGKWERRGAGITLGAKYSECMDTAHRRLDDEQRARFDAALHRPNIAFPTAGTGVSRSSRASVVLGPEEDDDVRRRDFGTALVGLPVLAAACAKPDTAAMPVSVSDLVGGGRVAPELVDYFRSQLSGHYLADMYLGPLYLVPTVRAQTELLVRLVGTADRSVRRGLLEIGTAYAALLGWLYQDAGDRAASASWRDTTLAFAHRSGNPQLVSYGLSNMAMLALDQDDGRAVIDYAQAARAAGARLSPKARVMALQHEAQGHAMLGDRATADRLLDEAVPLLSRIDDEQPWGNACCRTPYYMEVQRATCYGRTGSAQGAAAAAALWDEIMDVMPASARRDNAVFRARQSAALARVPDPDRALWAAAEAMDASRVTGSARIRRELNKVVVQAESWVHTSAGRELRILVESAP GT:EXON 1|1-485:0| BL:SWS:NREP 1 BL:SWS:REP 52->205|METE_MYCPA|3e-05|32.2|143/756| SEG 310->319|aqaaraagar| SEG 393->398|aaaaaa| RP:PDB:NREP 1 RP:PDB:REP 40->83|3bdnA|3e-05|15.9|44/234| HM:PFM:NREP 1 HM:PFM:REP 54->84|PF01381|4.9e-05|25.8|31/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 43->83|1xwrA1|7e-05|17.1|41/79|a.35.1.9| HM:SCP:REP 43->83|1x57A1|0.0003|24.4|41/0|a.35.1.12|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 16 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------3-----43----------------11----11--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 16.5 SQ:SECSTR #######################################cHHHHHHHHHHHHHHHHTTTTTcccHHHHHHHTccHHHHHHHTTTcTTccHHHHHHHHHTccHHHHHHHHTTcccTTcHH############################################################################################################################################################################################################################################################################################################################################################################## DISOP:02AL 1-2, 84-91, 126-134, 483-485| PSIPRED ccEEEEEEEcccHHHHHcHHHcHHHHHHHHcccccccccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHcccccccHHHcccccccccccccccHHcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccc //