[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57604.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  168/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:346 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   88->194 3e4rA PDBj 2e-05 32.4 %
:RPS:PDB   44->200 2de3B PDBj 5e-18 20.6 %
:RPS:SCOP  54->197 1us4A  c.94.1.1 * 1e-11 25.0 %
:HMM:SCOP  42->272 1xs5A_ c.94.1.1 * 5.6e-40 27.0 %
:RPS:PFM   69->248 PF09084 * NMT1 5e-19 33.5 %
:HMM:PFM   55->267 PF09084 * NMT1 1.9e-50 29.7 212/216  
:BLT:SWISS 64->249 Y4186_BRUSU 3e-11 31.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57604.1 GT:GENE BAD57604.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2920028..2921068 GB:FROM 2920028 GB:TO 2921068 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57604.1 LENGTH 346 SQ:AASEQ MTFRTRTRTTIGAAALASILALTGCGGGGTEAKAPGADGATTEVSLMLNWYPYGEHAPFYYGVQEGIFAKHGIDLKISAGQGSTKTAQATGANQTDFGWADTPAVLSNIDKGVKIKSVGVFLQTTPSAVQVFADSDIRTPADLAGKTIAVSAGDAPTTTFPMYLDKAGVPADQVTQQSLDSAGKMSAMLSGRVDGLIGFAHDQGPTIANKSGKEVRYLRYSDQALNFYSNGLIANQETIASSPELVQAMVDATSEAFAAAVAAPEQAVAAMEGKDPQLPPQSVLLEQWQQTIPLLSTPETAGKAPGTNVEANWRATVEVLSEAKLLEKAEDPAKYWDSAFTPASQP GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 64->249|Y4186_BRUSU|3e-11|31.2|173/319| SEG 2->24|tfrtrtrttigaaalasilaltg| SEG 250->272|vdatseafaaavaapeqavaame| BL:PDB:NREP 1 BL:PDB:REP 88->194|3e4rA|2e-05|32.4|105/291| RP:PDB:NREP 1 RP:PDB:REP 44->200|2de3B|5e-18|20.6|155/347| RP:PFM:NREP 1 RP:PFM:REP 69->248|PF09084|5e-19|33.5|179/200|NMT1| HM:PFM:NREP 1 HM:PFM:REP 55->267|PF09084|1.9e-50|29.7|212/216|NMT1| RP:SCP:NREP 1 RP:SCP:REP 54->197|1us4A|1e-11|25.0|144/298|c.94.1.1| HM:SCP:REP 42->272|1xs5A_|5.6e-40|27.0|222/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 253 OP:NHOMOORG 170 OP:PATTERN -------------------------------------------------------------------- ----------1--------------2-------1111----1---3---11---------11--1-1111-1111-------2-------------------------------------1111------------11111---41-------23---------------------------------------222212222222222-1----221-------------121---------------------------------------------------------------------------------------------1--------------------1----------1-----1---------1-111-------423--21-13-22222222212-1111111--11-333211-221--71---2111122211---------------1-----------------------------------11-1--------------1---------11121-----112--21--63-1------------------1-122-3121-------1-11----1-----111--------------------1--------------------------------------1---1-------------------------------------------122---------------------1------------------------------------112111------------------1--------------1--11-------------------------------------------1------------------------------------------------1-1-1-1- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 82.1 SQ:SECSTR ##########################################EccEEEEEEEcccccHHHHHHHTTHHHHTTEEEEEccGGGTTHHHHcccTTEEEEEccHHHHHHHHTTcTTcEEEEEEEEEcccEEEEEcTTcccccGGGGTTcEEEEcHHHHHHHHTccTTGGGccHHHHHHHHHHTTHHHHHHHHHHHHHTTccGGGcEEEEcccTTTcccHHHHHHcccccHHcHHHHHHHHHHTTccccEEEHHHHHHHHHHHHHHcGGGGHHHHHHHcTTccH#HHHHHHHHHHccHHHHc######cHHHHHHHHHHHHHHHHHTTccccccccc############# DISOP:02AL 1-4, 31-39, 344-346| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHcccEEEEEEcHHHHHHHHHccccEEEEEEEEccccEEEEEEcccccccHHHHcccEEEEEccccHHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHcccEEEEEEEcccHHHHHHHHcccccEEEEcccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccHHHHccHHHcccccc //