[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57611.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  96/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:441 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  31->234 2fnaA2 c.37.1.20 * 5.6e-11 25.4 %
:HMM:PFM   38->84 PF01637 * Arch_ATPase 0.00074 21.3 47/234  
:BLT:SWISS 46->432 Y2031_MYCBO 3e-24 31.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57611.1 GT:GENE BAD57611.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2927772..2929097) GB:FROM 2927772 GB:TO 2929097 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57611.1 LENGTH 441 SQ:AASEQ MIRQIHIKWFGRSTECDSMELMRMGVDYLPRHAAQLVKEALEDTRVVIVNGARQTGKSTLAEHCVKDHPNVVKRYLDDPRTRDAAADDPVAFLDAPGLMLIDEVQRVPDLWLAIKHTVDRDPRPGRFLLTGSARLLGLSSLPDAMPGRSETIELFPLSQGEISGAPDGFIDAAFTYGRHLEIPDSGLRRRDYLALAARGGYPESVHRTSDRRRAQFARSYLDDIMTRDIRQVADIQRAADMRRLIVTLAAQSGGLLNYDRLASALSMPASTIRNYVAILELIYLVRLVPAWSANATMRAVATPKVVFTDSGLAGHLLAGITNDATTGGLLETFVIGELTRQLTWSHSLAQLHHYRDRDGHEVDALLENNAGQVVAIEVKAAETVRSEDFRGLRHLQRRLGDRFHAGFVLYCGDQQLPFGDQLAALPISALWTAENPHRSAE GT:EXON 1|1-441:0| BL:SWS:NREP 1 BL:SWS:REP 46->432|Y2031_MYCBO|3e-24|31.6|342/441| SEG 77->91|ddprtrdaaaddpva| SEG 186->200|glrrrdylalaargg| HM:PFM:NREP 1 HM:PFM:REP 38->84|PF01637|0.00074|21.3|47/234|Arch_ATPase| HM:SCP:REP 31->234|2fnaA2|5.6e-11|25.4|189/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 217 OP:NHOMOORG 102 OP:PATTERN --------------------------------2-------------12-----------1--1----- ----11-----------45-4-----44444-----1----2-2-1----------------11--------111-33-------1--21-----13-------1--8-2-----------------1531143-1---21---------11----------------------------------31------------------------------------------------------------------------------------------------------------------------------------------------------------------------33----------------3-2-------------------------------1---------11-----1112-11-------1-2-----------------1-----------------1-6611411-11-------------------------------------------------------12-----1----------------1-----4--1---------1-11-3--------51-------------------------------1--1--------------------------1-----------------------------------------------------------------------------------------------67437-1-------1111-------------------------------------------------------------------------------------------------------------1-------3------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 135-145, 434-441| PSIPRED ccEEEccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHccccEEEEEcHHHcccHHHHHHHHHHccccccEEEEEcccHHHHHHHHcccccccEEEEEEccccHHHHHHccccHHHHHHHHcHHcccHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccEEEEEcccEEEEEHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEEEccccEEEEEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEcccEEEEEEHHHHcccccccccc //