[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57615.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  102/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->119 1r1vB PDBj 1e-10 34.1 %
:RPS:PDB   44->111 1bibA PDBj 4e-12 20.6 %
:RPS:SCOP  27->118 1fnnA1  a.4.5.11 * 1e-13 15.2 %
:HMM:SCOP  15->121 1u2wA1 a.4.5.5 * 3.6e-22 38.3 %
:RPS:PFM   44->88 PF01022 * HTH_5 3e-05 53.3 %
:HMM:PFM   44->90 PF01022 * HTH_5 8.1e-13 51.1 47/47  
:BLT:SWISS 28->119 CZRA_BACSU 2e-10 33.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57615.1 GT:GENE BAD57615.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2937594..2937980) GB:FROM 2937594 GB:TO 2937980 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57615.1 LENGTH 128 SQ:AASEQ MRVVRAMAERVAGEPASRASLRHPVSPDHRRLEAATGIFQMLADPTRLHLLWLLSHGEADVTALVESCGAARTAVSQHLAKLRFTGLVDTRREGRRVIYRLRGGHVARLVQEGLNQADHLVTGEPPHE GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 28->119|CZRA_BACSU|2e-10|33.7|92/107| BL:PDB:NREP 1 BL:PDB:REP 32->119|1r1vB|1e-10|34.1|88/96| RP:PDB:NREP 1 RP:PDB:REP 44->111|1bibA|4e-12|20.6|68/294| RP:PFM:NREP 1 RP:PFM:REP 44->88|PF01022|3e-05|53.3|45/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 44->90|PF01022|8.1e-13|51.1|47/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 27->118|1fnnA1|1e-13|15.2|92/103|a.4.5.11| HM:SCP:REP 15->121|1u2wA1|3.6e-22|38.3|107/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 155 OP:NHOMOORG 103 OP:PATTERN ------------------------------------------------1------------------- -1--2---11--1-22222-24--2-22222152532214-----11-----4-7--1-111--2121321-------1--11----------------------------------------------1-------------------------------------------------------1-----1--------------------------131---------------------------1----1-1--1-------1111-1-----------------------------------------------------------------------11-1---------121-----1--------1-----1--------1-------------------1--2----------1--1--1-----1--2----1-11------------------1--------------------------------1-------------------------------111-------1------------1----------------1---1-------------------1------1-----------------------------------------------------------------1-----------------------------------------------------------------------------1----------------------------------------------------------------1------------------------------------1-------------111111-----------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 80.5 SQ:SECSTR #########################cTETTTEEccHHHHHccccHHHHHHHHHHTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTcccccEHTTTccHH DISOP:02AL 20-30, 119-128| PSIPRED ccccHHHHHccccccccccHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccEEEEEEccHHHHHHHHHHHHHHHHHHHcccccc //