[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57627.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  484/915 : Eukaryota  12/199 : Viruses  1/175   --->[See Alignment]
f.38.1
:451 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   81->220 2d33D PDBj 1e-05 10.4 %
:RPS:SCOP  15->426 1pw4A  f.38.1.1 * 7e-07 14.3 %
:HMM:SCOP  3->443 1pw4A_ f.38.1.1 * 2.1e-63 29.6 %
:RPS:PFM   59->329 PF00083 * Sugar_tr 4e-06 32.4 %
:HMM:PFM   59->369 PF07690 * MFS_1 5.9e-27 25.9 290/353  
:BLT:SWISS 15->430 YHJE_ECOLI 7e-68 40.6 %
:PROS 302->318|PS00216|SUGAR_TRANSPORT_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57627.1 GT:GENE BAD57627.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2949754..2951109 GB:FROM 2949754 GB:TO 2951109 GB:DIRECTION + GB:PRODUCT putative transporter GB:PROTEIN_ID BAD57627.1 LENGTH 451 SQ:AASEQ MRMSSVLPQATDVDRRRVALATVVGTAVEWYDYFVYAAAAGLVFGTLFFEPAGPGFGTILSFLTVGISFLFRPLGAFLAGHFGDKVGRRPVLVTTLILMGTATALIGLLPTYEAIGIGAPLLLVLLRVLQGVSAGGEWGGAVLMAVEHAPRHRRGLFGAMPQIGVPIGLLLASAMMASMDALFPGEAFLDWGWRIPFLFSVVLIAVGAWVRRRVEESPVFAEIAERKEQTKAPVVDLFARFTPLVLLSALVFAGNSTVGYMTTGGYIQGYATNAEGLALDRGPVLWAVTASSLSWLLATFAAGWISDAIGRRATYIIGWCLQGVFVLTLFPLVNTGEVVLLGAGLVLLTLGLGFTYGAQSAWYTELFPASVRFSGVSISYAIGSIVGGAFAPTIAQWIQQSTGSSANVAYYLLAMTGVGLVGTVLLRDRKGIDLSPSNEAQQQTGIYAWEK GT:EXON 1|1-451:0| BL:SWS:NREP 1 BL:SWS:REP 15->430|YHJE_ECOLI|7e-68|40.6|414/440| PROS 302->318|PS00216|SUGAR_TRANSPORT_1|PDOC00190| TM:NTM 11 TM:REGION 31->53| TM:REGION 56->78| TM:REGION 90->112| TM:REGION 114->136| TM:REGION 162->184| TM:REGION 189->210| TM:REGION 233->255| TM:REGION 281->303| TM:REGION 323->345| TM:REGION 373->395| TM:REGION 404->426| SEG 121->129|lllvllrvl| SEG 169->182|lllasammasmdal| SEG 335->357|tgevvllgaglvlltlglgftyg| RP:PDB:NREP 1 RP:PDB:REP 81->220|2d33D|1e-05|10.4|125/499| RP:PFM:NREP 1 RP:PFM:REP 59->329|PF00083|4e-06|32.4|256/433|Sugar_tr| HM:PFM:NREP 1 HM:PFM:REP 59->369|PF07690|5.9e-27|25.9|290/353|MFS_1| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00083|IPR005828| GO:PFM GO:0006810|"GO:transport"|PF00083|IPR005828| GO:PFM GO:0016021|"GO:integral to membrane"|PF00083|IPR005828| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00083|IPR005828| RP:SCP:NREP 1 RP:SCP:REP 15->426|1pw4A|7e-07|14.3|384/434|f.38.1.1| HM:SCP:REP 3->443|1pw4A_|2.1e-63|29.6|409/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 2828 OP:NHOMOORG 516 OP:PATTERN ------3868997694-623322--------------------------------------113---- 111-131577C-2154433-37--2U3333325999DNno--224-1-1441PJL726-----338Q87311111222-13-B--111--------1--1-2---2-2-2-----------------1-1---1-------11111--------------121---1-----1-----1-----1--------1222222211222222------222-23--1-------1-1111111111111112-112----22-2-----11-1---11--------------------------------------------------------------------------------------------------1--44461442452G551-32323244444443435-66B55G7D231-666622454544D4-----5-----1-54555555344121-1442334441122457975E4454453233-1564-63346XOOVQTCFIIEVVaNKMKICIWJYAIDB-5FC832622611-9436---1141-------11--1-1--1----21--------------111111-----1-5455341-1211211-------1-1---------------1--------------1---------87782875779688866-776678766778666566778766--29989899997889898944754551-333333233332----11111575711-11-------22211--188889571125-AAC9CFE91FGGG-B9A96655A666----------1----55545444441111---------------------------------------------------------1- -----------------------------------------------------------------------------------------------2-------1----3------------------------------------------------------3------------11-----1----1---241---1 --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- STR:NPRED 125 STR:RPRED 27.7 SQ:SECSTR ################################################################################TTcccccTTccccccHHHHHHHHHHHHHcccHHHHTTcc########EETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEE#######EEEEEEccTTcTTcccHHHHHHHHHHHHHHHHcccccc####################################################################################################################################################################################################################################### DISOP:02AL 1-16, 219-233, 432-449| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHcccccccc //