[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57629.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  111/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.110.2
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->217 1mkmB PDBj 5e-10 27.0 %
:RPS:PDB   7->58 3dp7B PDBj 8e-09 19.2 %
:RPS:PDB   87->217 3d3oB PDBj 6e-16 13.8 %
:RPS:SCOP  12->64 1mkmA1  a.4.5.33 * 2e-10 24.5 %
:RPS:SCOP  87->209 1td5A  d.110.2.2 * 2e-13 27.3 %
:HMM:SCOP  11->85 1mkmA1 a.4.5.33 * 2.3e-16 46.7 %
:HMM:SCOP  84->232 1mkmA2 d.110.2.2 * 2.7e-25 37.8 %
:RPS:PFM   14->63 PF09339 * HTH_IclR 6e-05 44.0 %
:RPS:PFM   129->203 PF01614 * IclR 1e-04 46.7 %
:HMM:PFM   13->64 PF09339 * HTH_IclR 2e-17 36.5 52/52  
:HMM:PFM   158->210 PF01614 * IclR 1.8e-08 33.3 51/129  
:BLT:SWISS 12->188 ICLR_SALTY 2e-10 28.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57629.1 GT:GENE BAD57629.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2953237..2953935) GB:FROM 2953237 GB:TO 2953935 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57629.1 LENGTH 232 SQ:AASEQ MPEKPGSSAGSQTLSRGIRLLEILAAAGRAMSIDELAGALGVHRSVAYRLLRTLEDHGLIARDPAGRLVLGAGLAALAAGVDRDLQAAALPELKAVANELGMTCLLAVRLDGDEAVTLTSAAPEQSVAVAYRPGHRHPLTRGGPGKAILLELPQDTWPDDLRDELTASRARGYAVSHDEVVPSLRSVAVPLIAPGQPAASIAVIHVSLPRPEDEIAQRLTTAAAAVVRALGG GT:EXON 1|1-232:0| BL:SWS:NREP 1 BL:SWS:REP 12->188|ICLR_SALTY|2e-10|28.2|177/274| SEG 65->85|agrlvlgaglaalaagvdrdl| SEG 218->231|rlttaaaavvralg| BL:PDB:NREP 1 BL:PDB:REP 13->217|1mkmB|5e-10|27.0|204/247| RP:PDB:NREP 2 RP:PDB:REP 7->58|3dp7B|8e-09|19.2|52/350| RP:PDB:REP 87->217|3d3oB|6e-16|13.8|130/163| RP:PFM:NREP 2 RP:PFM:REP 14->63|PF09339|6e-05|44.0|50/52|HTH_IclR| RP:PFM:REP 129->203|PF01614|1e-04|46.7|75/127|IclR| HM:PFM:NREP 2 HM:PFM:REP 13->64|PF09339|2e-17|36.5|52/52|HTH_IclR| HM:PFM:REP 158->210|PF01614|1.8e-08|33.3|51/129|IclR| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF09339|IPR005471| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF09339|IPR005471| RP:SCP:NREP 2 RP:SCP:REP 12->64|1mkmA1|2e-10|24.5|53/75|a.4.5.33| RP:SCP:REP 87->209|1td5A|2e-13|27.3|121/179|d.110.2.2| HM:SCP:REP 11->85|1mkmA1|2.3e-16|46.7|75/0|a.4.5.33|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 84->232|1mkmA2|2.7e-25|37.8|148/0|d.110.2.2|1/1|GAF domain-like| OP:NHOMO 147 OP:NHOMOORG 111 OP:PATTERN -------------------------------------------------------------------- ----1--11111---1111-12--1211111111112143-1-2211-----221111--111-3262321-----------2-------------------------------------------------------------------------------------------------------121--2-----------------1---------------------1-------------------------------------------------------------------------------------------1------------------------------------1-1-11---1------------------11---1--1---------------------11--1112--------2----1-3------1-----------------------------------------------1---1211--------1111--111111112-3-11-----------1-1-1-------------------------------------------1---------------------------------------------------------------------------------------------------------------------2------------------------1-------------------------------------1----------------------------------1-------1----------------------------1-1--111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 90.9 SQ:SECSTR ######HHHHHHHHHHHTTHHHHHHHcTTcEEHHHHHHHHTcccHHHHHHHHHHHHHTcEEEEEEEEETTEEEEEEEEcccEEEEcHHHHHHHHHHHHHHccEEEEEEETETTEEEEEEEEcccccccccccccccEEGGcHHHHHTTcHHHHHHcccccHHHHHHHHHHHcEEEEEccccTTEEEEEEEccccTccEEEEEEEHHHHHHTHHHHHH############### DISOP:02AL 1-12| PSIPRED cccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHEEcccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEEEEEcccccEEEEEcccccccHHccHHHHHHHHHccccccHHHHHHHHHHHHHcccEEEccccccccEEEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcc //