[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57630.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  130/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   238->313 2k9sA PDBj 4e-07 34.7 %
:RPS:PDB   237->319 1bl0A PDBj 3e-17 26.8 %
:RPS:SCOP  237->313 1v4aA1  a.24.16.4 * 6e-12 14.5 %
:HMM:SCOP  214->263 1d5yA1 a.4.1.8 * 0.00042 26.0 %
:HMM:SCOP  264->314 1d5yA2 a.4.1.8 * 8.1e-12 40.0 %
:RPS:PFM   278->312 PF00165 * HTH_AraC 3e-06 42.9 %
:HMM:PFM   278->312 PF00165 * HTH_AraC 1.2e-12 44.1 34/42  
:HMM:PFM   193->285 PF10098 * DUF2336 0.00095 19.4 93/262  
:BLT:SWISS 16->312 FEAR_ECOLI 2e-14 23.0 %
:PROS 265->308|PS00041|HTH_ARAC_FAMILY_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57630.1 GT:GENE BAD57630.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2954060..2955034 GB:FROM 2954060 GB:TO 2955034 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57630.1 LENGTH 324 SQ:AASEQ MTVGDLAPLRHDCGPDDSLLAWRVQVTDFFPPLAIEPLGARFTGSISGARSRELQVTEIVGSAHHVARRPAGHRTSDGEYFKLNVQLDGHGFVRQAGNETRLAPGSIAIYDFAQPYDLVFDGDSRFLVALFPKDALGLPDALAADLMAAPLAADDGTAPLVSSYLRSLAENLGLLAGPSGAKVSRVFLDLVTTFLGEQLNRRIGSARADLGTLTMTILRYIDDHLADPDLDPARLAEAHHISVRYLHKLFEPTGVSVGQWIRQRRLEHARAELTGRADLAVAEVAHRSGFVDPGYFGRVFKQAYGMTPGQWRANRALSSYTSAR GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 16->312|FEAR_ECOLI|2e-14|23.0|291/301| PROS 265->308|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| SEG 134->156|dalglpdalaadlmaaplaaddg| SEG 222->236|ddhladpdldparla| BL:PDB:NREP 1 BL:PDB:REP 238->313|2k9sA|4e-07|34.7|75/107| RP:PDB:NREP 1 RP:PDB:REP 237->319|1bl0A|3e-17|26.8|82/116| RP:PFM:NREP 1 RP:PFM:REP 278->312|PF00165|3e-06|42.9|35/40|HTH_AraC| HM:PFM:NREP 2 HM:PFM:REP 278->312|PF00165|1.2e-12|44.1|34/42|HTH_AraC| HM:PFM:REP 193->285|PF10098|0.00095|19.4|93/262|DUF2336| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| RP:SCP:NREP 1 RP:SCP:REP 237->313|1v4aA1|6e-12|14.5|76/151|a.24.16.4| HM:SCP:REP 214->263|1d5yA1|0.00042|26.0|50/54|a.4.1.8|1/2|Homeodomain-like| HM:SCP:REP 264->314|1d5yA2|8.1e-12|40.0|50/0|a.4.1.8|1/1|Homeodomain-like| OP:NHOMO 176 OP:NHOMOORG 131 OP:PATTERN -------------------------------------------------------------------- -----1-1111-------------2------1----5275---1--------3211-----------22----------------------------------------------------------------------11--------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------2-123---------------1---------1-3----11121-----1-------11----1-------------------------------------------------11--1----222232-111111-21111112-31-1---11--51--21--21----1---------------------------------------------------------------------------------------------------------1-------------1------1111111111-1111111111111111111--------1111111111111111-1-11111---------------------------1----------------------------------------111----1------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 25.9 SQ:SECSTR ############################################################################################################################################################################################################################################HHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHTccccccT#### DISOP:02AL 197-212, 312-324| PSIPRED cccccccccEEcccHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccEEEEEEEEccEEEEEcHHHHccccccEEEEEEEEEcEEEEEEccEEEEEcccEEEEEccccEEEEEEcccccEEEEEEcHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHccccccc //