[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57632.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  316/915 : Eukaryota  157/199 : Viruses  1/175   --->[See Alignment]
c.3.1d.16.1
:514 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->494 2jbvB PDBj 4e-56 35.1 %
:RPS:PDB   24->505 1cf3A PDBj 3e-46 25.5 %
:RPS:SCOP  25->290 1ju2A1  c.3.1.2 * 5e-46 26.9 %
:RPS:SCOP  309->446 1cf3A2  d.16.1.1 * 7e-23 17.5 %
:RPS:SCOP  436->503 1ju2A1  c.3.1.2 * 8e-06 19.1 %
:HMM:SCOP  1->505 1gpeA1 c.3.1.2 * 5.3e-79 36.8 %
:RPS:PFM   24->288 PF00732 * GMC_oxred_N 3e-53 47.9 %
:RPS:PFM   361->494 PF05199 * GMC_oxred_C 3e-13 41.4 %
:HMM:PFM   6->289 PF00732 * GMC_oxred_N 1.7e-73 39.8 284/298  
:HMM:PFM   359->494 PF05199 * GMC_oxred_C 2.4e-42 43.0 135/145  
:BLT:SWISS 20->501 ALKJ_PSEPU 5e-78 38.2 %
:PROS 248->262|PS00624|GMC_OXRED_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57632.1 GT:GENE BAD57632.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2956568..2958112 GB:FROM 2956568 GB:TO 2958112 GB:DIRECTION + GB:PRODUCT putative oxidoreductase GB:PROTEIN_ID BAD57632.1 LENGTH 514 SQ:AASEQ MTTTSVIVVGAGSAGSVVARRLVDAGVRVTLLEAGGEDTNPAIHDLSRMGELWHSPDDWDYYTVPQRGAAGRRLHLPRGKVLGGSHALNATIWVRGAPADYDHWAEVAGPDWAWENVLPVYRAIEDFSGGASEYHGAGGPLPVDNDYPLDPIHRSIVAAAVQAGIPFNPDYNGASLEGISKEQINVRDGERVNTWKAYLAPVRDRLTVRTGAHVHSVVIEDGRAIGVRYRHDGQDAEAWADEVVLAAGALDSPQVLLRSGIGPAADLEALGIEVVRDAPQVGKNLHDHLLVPVIVRTRRPIPPPRTGVSVTQTHLFARSRPDLAVPDTQPLFFAVPMYSEGMTPIEGSAFTLHSGIVTPASRGSVTLTGPKLDDPANIDLGALEHPDDLAAFLFTVRQCREIAAQPALAEEWGAEEVYPGPAVRSDAELVDYIRRTVVTYHHQVGTCRMGADDAAVVDPRLRVRGVDGLRVVDASIMPRVTTGNTNAPSVLIGEFGARYLLADLGLDRTGFIEP GT:EXON 1|1-514:0| BL:SWS:NREP 1 BL:SWS:REP 20->501|ALKJ_PSEPU|5e-78|38.2|477/552| PROS 248->262|PS00624|GMC_OXRED_2|PDOC00543| SEG 5->19|svivvgagsagsvva| SEG 291->306|vpvivrtrrpippprt| SEG 460->473|rlrvrgvdglrvvd| BL:PDB:NREP 1 BL:PDB:REP 24->494|2jbvB|4e-56|35.1|467/530| RP:PDB:NREP 1 RP:PDB:REP 24->505|1cf3A|3e-46|25.5|479/581| RP:PFM:NREP 2 RP:PFM:REP 24->288|PF00732|3e-53|47.9|265/296|GMC_oxred_N| RP:PFM:REP 361->494|PF05199|3e-13|41.4|133/140|GMC_oxred_C| HM:PFM:NREP 2 HM:PFM:REP 6->289|PF00732|1.7e-73|39.8|284/298|GMC_oxred_N| HM:PFM:REP 359->494|PF05199|2.4e-42|43.0|135/145|GMC_oxred_C| GO:PFM:NREP 3 GO:PFM GO:0016614|"GO:oxidoreductase activity, acting on CH-OH group of donors"|PF00732|IPR000172| GO:PFM GO:0050660|"GO:FAD binding"|PF00732|IPR000172| GO:PFM GO:0016614|"GO:oxidoreductase activity, acting on CH-OH group of donors"|PF05199|IPR007867| RP:SCP:NREP 3 RP:SCP:REP 25->290|1ju2A1|5e-46|26.9|245/351|c.3.1.2| RP:SCP:REP 309->446|1cf3A2|7e-23|17.5|137/196|d.16.1.1| RP:SCP:REP 436->503|1ju2A1|8e-06|19.1|64/351|c.3.1.2| HM:SCP:REP 1->505|1gpeA1|5.3e-79|36.8|340/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 1892 OP:NHOMOORG 475 OP:PATTERN --------------------------------------------1----------------------- ---1211----11133222-24--4722222254443156----1-1--1--2222-2--211-216312------------1-----------------------------------------------------------------2------------------1-2---------------1---------------------------------------------11-1111111111111111111---------------------------------------------------------------------------------------------------------------------------4331-------766--23324345485353453-213--423393-93314585577622-21237222253622222222222-1-1------------------------------12591-242-2845777444444489444436H495665-14222112232223912----11--------1-1----1---11----------------------1--------------------------------23-41221-1111111------11-11---1---------11----21111111111-111111-11111111-11-121111-1----------------2-----1----1-1111-1111--------------4123---------------111211122---44443333234222111-------------2-----112221111211------------------------------------------------------------------ ----111-211---1EEPDH8ACPQQK5567664433443333444LFCECHNLHGEE42131----------2------2--------UZUEXJA32223892-1-1924111113111111132111251-111111111111-11111111111129JF6B2HiFJMe1123111-----11-267J372177664 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---- STR:NPRED 492 STR:RPRED 95.7 SQ:SECSTR ###################HHHHcTTccEEEEEcccccTcHHHHcGGGTTTTTTcTTcccEEcccccTTTccccEEcccccTTGGGGTcccccccccHHHHHHHHHTTcTTccHHHHHHHHHHHEEEccccGGGccccccEEEcccccccTHHHHHHHHHHTTTccccccTTcccccEEEccccccTTcccccHHHHHTGGGTTcEEEEEccEEEEEEEEccEEEEEEEEETTEEEEEEEEEEEEcccTTTHHHHHHHTTcccHHHHGGGTcccccccccTTccccccEEEEEEEEEcGGGccccEEEHHHHTTccccHHHHHHHHHHHHHHHHTTccEEEEEEEcTTEEEEEEEEcccccccEEEEccccGGccEEEEccTTccHHHHHHHHHHHHHHHHHHTcGGHGGGTEEEEEEcGGGccTTccHHHHGGGccEEccccccTTccccGGTccccTTcccTTcccEEEccTTccccccccccHHHHHHHHHHHHHHHHHHHHTccccc### DISOP:02AL 510-514| PSIPRED ccEEEEEEEcccHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHccccccEEcccccccccccccEEcccccccccHHHHHHHEEccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccEEEccccccccHHHHHHHHHHHHcccEEcccccccccEEEEEccccccccccccHHHHHHHHHHcccEEEEccEEEEEEEEccEEEEEEEEEccEEEEEEEEEEEEEccHHHHHHHHHHcccccHHHHHHcccccccccHHHHHHHHHcccEEEEEEEcccccccccccccccEEEEEEEccccccccccEEEEEEEcccccccccccccEEEEEEcccccccEEEEEcccccccccEEEccccccHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccccHHHHHHHHHHHccEEEccccccEEccccccEEccccEEEccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccc //