[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57636.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->187 2nx4A PDBj 2e-60 54.0 %
:RPS:PDB   8->192 2dg7A PDBj 9e-18 14.7 %
:RPS:SCOP  10->72 1z77A1  a.4.1.9 * 2e-12 31.7 %
:RPS:SCOP  97->190 2i10A2  a.121.1.1 * 2e-05 11.7 %
:HMM:SCOP  4->80 2gfnA1 a.4.1.9 * 1.8e-16 32.5 %
:HMM:SCOP  79->196 2gfnA2 a.121.1.1 * 1.7e-19 26.3 %
:RPS:PFM   14->57 PF00440 * TetR_N 8e-06 47.7 %
:HMM:PFM   14->57 PF00440 * TetR_N 1.1e-15 40.9 44/47  
:BLT:SWISS 1->181 PKSA_BACSU 5e-20 30.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57636.1 GT:GENE BAD57636.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2962169..2962756 GB:FROM 2962169 GB:TO 2962756 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57636.1 LENGTH 195 SQ:AASEQ MPKLVDHAERRQAITAAVWRLIADRGLEALNMRDIAAEAGYANGSLKHYFKGKDDLLRFAYQHVFDATNRRVAAALGEATGLAAIRLFCREVLPVTAETLQEARIAIALWQRAVYDEPLGAVNERALADWRERLIDFLDQARDAGEITDVDTVVVADQILTLLMGAQITGVLTPATATPDRQLELLEALLDRIRT GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 1->181|PKSA_BACSU|5e-20|30.2|179/205| SEG 73->84|aaalgeatglaa| BL:PDB:NREP 1 BL:PDB:REP 1->187|2nx4A|2e-60|54.0|187/194| RP:PDB:NREP 1 RP:PDB:REP 8->192|2dg7A|9e-18|14.7|177/185| RP:PFM:NREP 1 RP:PFM:REP 14->57|PF00440|8e-06|47.7|44/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 14->57|PF00440|1.1e-15|40.9|44/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 10->72|1z77A1|2e-12|31.7|63/75|a.4.1.9| RP:SCP:REP 97->190|2i10A2|2e-05|11.7|94/110|a.121.1.1| HM:SCP:REP 4->80|2gfnA1|1.8e-16|32.5|77/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 79->196|2gfnA2|1.7e-19|26.3|118/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 49 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------2344----1----11-211-----11--114-1-------------1---------------------------------------------------------------2---11---------------------------------1-------1------1----------1111-----1----------1----------------------------------------------------------------------------------------------------------1------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 195 STR:RPRED 100.0 SQ:SECSTR ccccccHTTHHHHHHHHHHHHHHHccGGGccHHHHHHHTTccHHHHHHHcccTTGGGTTTccccHHHHHHHHHTccTTccHHHHHHHHHHHTTcHHHTTTTccTTHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHH DISOP:02AL 1-10| PSIPRED ccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcc //