[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57637.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->28 PF08085 * Entericidin 0.001 25.0 20/42  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57637.1 GT:GENE BAD57637.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2963074..2963601) GB:FROM 2963074 GB:TO 2963601 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57637.1 LENGTH 175 SQ:AASEQ MMRYRSVLIAAALSVAAVSITACGPKDTSAACSGETFNLHSHPELLGAENDLVRAFDEAAEQQLASATMVEMTTRAGWSPEWERVVYIGARTTDEELRKDSATDLRLACFAGLPTENSDPDLRSSHVTLFLADGKPLQAVWWVGQTPSLRFGKRDFLLPDTVLRYDPDSRTMRAE GT:EXON 1|1-175:0| TM:NTM 1 TM:REGION 5->23| SEG 6->20|svliaaalsvaavsi| HM:PFM:NREP 1 HM:PFM:REP 6->28|PF08085|0.001|25.0|20/42|Entericidin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 169-175| PSIPRED cccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccHHHHcccccccccEEEccccccccccccccccEEEEEEEccccEEEEEEEEccccHHHHHHHHcccccEEEEcccccccccc //