[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57640.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->85 PF02575 * DUF149 4.2e-05 13.9 79/93  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57640.1 GT:GENE BAD57640.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2965120..2965410) GB:FROM 2965120 GB:TO 2965410 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57640.1 LENGTH 96 SQ:AASEQ MTEDLERLAGHVAELDAAVHAVRGTACSPDGSVYMEVDIYGAITRLQLTDFAMERGPQRLAQLVTTCHDRAHAAAVTAARAAHDSVRAQQDSRGLR GT:EXON 1|1-96:0| SEG 70->83|rahaaavtaaraah| HM:PFM:NREP 1 HM:PFM:REP 7->85|PF02575|4.2e-05|13.9|79/93|DUF149| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 86-96| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //