[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57641.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->128 2hljA PDBj 3e-08 33.9 %
:RPS:PDB   10->137 2av9J PDBj 2e-12 13.6 %
:RPS:SCOP  15->128 2hljA1  d.38.1.1 * 2e-30 32.5 %
:HMM:SCOP  12->167 2hljA1 d.38.1.1 * 9.9e-36 36.5 %
:HMM:PFM   22->143 PF01643 * Acyl-ACP_TE 6.1e-07 19.0 121/249  
:BLT:SWISS 42->98 CC103_HUMAN 2e-04 42.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57641.1 GT:GENE BAD57641.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2965856..2966359 GB:FROM 2965856 GB:TO 2966359 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57641.1 LENGTH 167 SQ:AASEQ MAIDLPSVAQIRELPAVLEGRVSAREIDDNGHMNVLYYLEHNIRAADILLRAAGLDEQYRRERRLGLFTTEHHIAYYSELREGDPLTVHARVLERADKAVHMMTFLVDPQRERLSNTLEIMLVHVDLERRRAASMPEDLAAAVDDLVAVSGKLTWSAPVCGVMGIRR GT:EXON 1|1-167:0| BL:SWS:NREP 1 BL:SWS:REP 42->98|CC103_HUMAN|2e-04|42.9|56/100| SEG 138->149|dlaaavddlvav| BL:PDB:NREP 1 BL:PDB:REP 15->128|2hljA|3e-08|33.9|112/150| RP:PDB:NREP 1 RP:PDB:REP 10->137|2av9J|2e-12|13.6|125/137| HM:PFM:NREP 1 HM:PFM:REP 22->143|PF01643|6.1e-07|19.0|121/249|Acyl-ACP_TE| RP:SCP:NREP 1 RP:SCP:REP 15->128|2hljA1|2e-30|32.5|114/153|d.38.1.1| HM:SCP:REP 12->167|2hljA1|9.9e-36|36.5|156/0|d.38.1.1|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 58 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1----------------------2---2--------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------2111--11111--------------1--1----2--11-1-11--1-11----11-----1-----------------------------------------------------1--1111111-----1111------212---1-------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1--11-1-1----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 79.0 SQ:SECSTR #####cccccGGGccEEEEEEccGGGccTTccccTTHHHHHHHHHHHHHHHHHccccHHTTTccEEEEEEEEEEEEcccccTTcEEEEEEEEEEEcccEEEEEEEEEcTTcccccEEEEEEEEEEETTTcccccccH############################## DISOP:02AL 1-5| PSIPRED cccccccHHHHHHcccEEEEEEEHHEEccccEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccEEEEEEEcHHHHHHcccccEEEEEEEEEEEccEEEEEEEEEEEccccEEEEEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHcccccccHHHccccc //