[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57646.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   55->118 PF04075 * DUF385 3.9e-12 31.2 64/132  
:HMM:PFM   7->46 PF06103 * DUF948 0.00025 37.5 40/90  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57646.1 GT:GENE BAD57646.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2988079..2988570 GB:FROM 2988079 GB:TO 2988570 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57646.1 LENGTH 163 SQ:AASEQ MKVLIVLAVLIVAIPLLALATLLIGLRYRIAPIVDTVRRFNKKVTNRRVLRDAGTAGSPRALIRHVGRRSGRTYDTPVDVIPTDTGYVVALPYGTRADWLRNVLAAGSATVVTDGATVPIDQPALVPTAAVAGHLSPGTRLTLRLFRVDRCLQVRRAPVRESA GT:EXON 1|1-163:0| TM:NTM 1 TM:REGION 3->25| SEG 3->26|vlivlavlivaipllalatlligl| HM:PFM:NREP 2 HM:PFM:REP 55->118|PF04075|3.9e-12|31.2|64/132|DUF385| HM:PFM:REP 7->46|PF06103|0.00025|37.5|40/90|DUF948| OP:NHOMO 33 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--1311111-23331111-----2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 160-163| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccEEEEEccccccccEEcEEEEEccccEEEEEEccccccHHHHHHHHcccEEEEEcccEEEcccccEEccccccccccHHHHHHHHHccccHHHEEEcccccccc //