[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57651.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:245 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->242 PF01925 * TauE 1e-31 27.3 231/239  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57651.1 GT:GENE BAD57651.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2993549..2994286) GB:FROM 2993549 GB:TO 2994286 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57651.1 LENGTH 245 SQ:AASEQ MSVLTLSLVALAGFFAGVIGYVTGIASLISYPALLAAGLPPVAANVTNTVAMVAVGVGSTAKAGAGHAVEGRTLARYAAYSALGGTAGAALLLLTPADAFEVAVPFLLAAASLSLLAQPKLRELAGDREFPRLYPLGIFAVAVYGGYFGAGVGVMFLALILVCTSATMWRAGVLKSFLTGVANFVAAIGFAVFGPVHWLAAAAMAVGAFAGGWCGPPLVARLPPTAVRIAVAVCGTGLAAYLALS GT:EXON 1|1-245:0| TM:NTM 5 TM:REGION 11->33| TM:REGION 91->113| TM:REGION 139->161| TM:REGION 182->204| TM:REGION 224->245| SEG 32->58|pallaaglppvaanvtntvamvavgvg| SEG 78->99|aaysalggtagaalllltpada| SEG 107->117|llaaaslslla| SEG 139->154|favavyggyfgagvgv| SEG 200->212|aaaamavgafagg| HM:PFM:NREP 1 HM:PFM:REP 10->242|PF01925|1e-31|27.3|231/239|TauE| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 123-127| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHc //