[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57653.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->58 PF10738 * Lpp-LpqN 0.00023 27.1 48/241  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57653.1 GT:GENE BAD57653.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2995030..2995347) GB:FROM 2995030 GB:TO 2995347 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57653.1 LENGTH 105 SQ:AASEQ MMRTPLRLATASVAAASLVAAAASAAAAPAEPGPAHAIPVAASTGSSMVDSGAAALESAGYYLGRGDFLGLLVLVGVTPFQMLTGAVCDLGTGSGLPVPCTRPKY GT:EXON 1|1-105:0| TM:NTM 2 TM:REGION 6->27| TM:REGION 66->88| SEG 9->37|atasvaaaslvaaaasaaaapaepgpaha| SEG 63->77|lgrgdflgllvlvgv| HM:PFM:NREP 1 HM:PFM:REP 11->58|PF10738|0.00023|27.1|48/241|Lpp-LpqN| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 104-105| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccHHHHHHHHHHHHccEEcccHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccc //